Recombinant Rat Potassium voltage-gated channel subfamily S member 1 (Kcns1)

Shipped with Ice Packs
In Stock

Description

Role in Neuronal Excitability

Kcns1 modulates delayed-rectifier potassium currents in myelinated sensory neurons :

  • Mice lacking Kcns1 in peripheral neurons exhibit:

    • Increased basal mechanical pain sensitivity (+37% vs wild type)

    • Enhanced injury-induced mechanical allodynia

  • Expressed in Aδ nociceptors and Aβ mechanoreceptors, influencing action potential repolarization

Mechanistic Studies

  • Nerve injury rapidly downregulates Kcns1 mRNA in rats, correlating with pain onset

  • Spinal cord localization: Laminae III–V (sensory A-fiber termination zones)

Genetic and Clinical Relevance

AssociationEvidence Source
Chronic pain susceptibilityHuman KCNS1 SNPs
Phantom limb pain riskClinical cohorts
T-cell immunodeficiency (indirect)Gene homology

While not directly linked to cardiac function, related potassium channels (e.g., KCNQ1) influence cardiac repolarization , highlighting the broader importance of voltage-gated K+ channels.

Research Applications

This recombinant protein is primarily used for:

  1. Biochemical assays: Western blotting, protein interaction studies

  2. Functional studies: Electrophysiological characterization of Kv9.1 channels

  3. Pain mechanism models: Testing neuronal hyperexcitability in vitro

Critical Notes:

  • Not for human therapeutic use

  • Requires aliquoting to avoid freeze-thaw degradation

Comparative Expression Systems

While the rat variant is expressed in E. coli, homologs across species use diverse platforms:

SpeciesExpression HostPurityReference
Human (KCNS1)Mammalian cells≥85%
Mouse (Kcns1)Yeast/Baculovirus≥85%
Rhesus macaque (KCNS1)E. coli≥85%

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Kcns1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1; Voltage-gated potassium channel subunit Kv9.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-497
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcns1
Target Protein Sequence
MVSEFPGPGSRVPWRPRDEALRVNVGGVRRLLSARALARFPGTRLGRLQAAVSEEQARRL CDDYDAAAREFYFDRHPGFFLGLLHFYRTGHLHVLDELCVFAFGQEADYWGLGENALATC CRARYLERRVTRPRAWDEDSDAPSSVDPCPDEISDVQRELARYGAARCGRLRRRLWLTME NPGYSLPSKLFSCVSIGVVLASIAAMCIHSLPEYQAREAAAAVAAVAAGRSAEDVRDDPV LRRLEYFCIAWFSFEVSSRLLLAPSTRNFFCHPLNLIDIVSVLPFYLTLLAGAALGDRRG ASGEELGDLGKVVQVFRLMRIFRVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVS VFSGVAYTAEEKNVGFDTIPACWWWGTVSMTTVGYGDVVPETVAGKLAASGCILGGILVV ALPITIIFNKFSHFYRRQKALEAAVRSSGQREFEDLLSSVDGVSDVSLETSRETSQEGRS TDLETQAPSEPAKSHSY
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It can form functional heterotetrameric channels with KCNB1 and KCNB2, modulating the activation and deactivation rates of the delayed rectifier voltage-gated potassium channel of KCNB1 and KCNB2.
Gene References Into Functions
  1. Our findings demonstrate that Kv9.1 dysfunction leads to spontaneous and evoked neuronal hyperexcitability in myelinated fibers, associated with the development of neuropathic pain behaviors. PMID: 23197740
Database Links
Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.1/KCNS1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in brain, but not in the other tissues tested.

Q&A

What is the expression pattern of Kcns1 in the rat nervous system?

Kcns1 is predominantly expressed in the cell body and axons of myelinated sensory neurons positive for neurofilament-200, including Aδ-fiber nociceptors and low-threshold Aβ mechanoreceptors. In the spinal cord, Kcns1 is detected in laminae III to V of the dorsal horn where most sensory A fibers terminate, as well as large motoneurons of the ventral horn. Kcns1 is abundant in the dorsal root ganglia (DRG), spinal cord, and brain, but excluded from non-neuronal tissues such as muscle, heart, lung, kidney, and liver .

A systematic analysis of expression patterns can be conducted using the following methodological approach:

  • Immunohistochemistry with specific antibodies (e.g., rabbit anti-Kcns1)

  • Co-staining with neuronal markers (NeuN, β3-tubulin)

  • Fiber-type specific markers (peripherin, NF200, CGRP)

  • Quantification of positive cells using standardized criteria

How does Kcns1 function in sensory neurons?

Kcns1 (Kv9.1) is a modulatory potassium channel subunit that cannot form functional channels on its own but must heteromerize with members of the Kcnb (Kv2) family to influence neuronal excitability. The association of Kcns1 with Kcnb members stabilizes the resultant currents and promotes closed-state inactivation that attenuates excitability .

To study Kcns1 function in heterologous expression systems:

  • Clone full-length Kcns1 cDNA from mRNA isolated from neuronal tissue

  • Co-express with Kcnb family members in expression systems (e.g., HEK293T cells)

  • Perform electrophysiological recordings to assess channel properties

  • Compare current properties between Kcnb alone vs. Kcnb/Kcns1 heteromers

What methodologies are used to generate recombinant Kcns1 protein?

Recombinant Kcns1 proteins can be generated using bacterial expression systems. A common approach involves:

  • PCR amplification of the Kcns1 gene from rat tissue

  • Cloning into an appropriate expression vector with fusion tags (e.g., His-tag)

  • Transformation into E. coli expression host

  • Induction of protein expression under optimized conditions

  • Purification using affinity chromatography (e.g., Ni-NTA for His-tagged proteins)

  • Validation of purity by SDS-PAGE (>85% purity standard)

For optimal storage and handling of recombinant Kcns1:

  • Store at -20°C/-80°C upon receipt

  • Avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

How can quasi-experimental designs be implemented to study Kcns1 function in pain models?

Quasi-experimental designs are particularly valuable for Kcns1 research when randomized controlled trials are not feasible or ethical. For studying Kcns1 in pain models:

Design TypeApplication in Kcns1 ResearchStrengthsLimitations
Non-equivalent control groupCompare Kcns1 knockout vs. wild-type animalsControls for maturation and history effectsSelection bias possible
Multiple baselineMeasure pain thresholds before and after Kcns1 manipulation at different timepointsControls for regression to the meanTime-intensive
Interrupted time-seriesAssess pain behaviors before and after Kcns1-targeting interventionsGood for detecting sudden changes in responseExternal events may confound results

When implementing quasi-experimental designs for Kcns1 research:

  • Clearly define dependent variables (e.g., mechanical threshold, thermal latency)

  • Select appropriate comparison groups (e.g., heterozygous vs. homozygous knockouts)

  • Conduct multiple pre-tests to establish stable baselines

  • Include appropriate controls for threats to internal validity 8

How do genetic approaches inform our understanding of Kcns1 function in neuropathic pain?

Genetic approaches have revealed crucial insights into Kcns1's role in pain processing:

  • Transgenic mouse models: Generate conditional knockout mice using Cre-loxP technology to selectively inactivate Kcns1 in specific tissues. For example, crossing Kcns1-floxed mice with AdvCreERT2 mice allows for tamoxifen-inducible deletion specifically in dorsal root ganglion neurons .

  • Human genetic studies: KCNS1 polymorphisms have been linked to:

    • Basal pain sensitivity

    • Phantom limb pain

    • Back pain

    • HIV-associated pain

  • Network analysis: Unbiased network analysis of gene expression profiles reveals that Kcns1 is co-regulated with other pain-related genes:

    • 83% of Kcns1's 30 nearest co-associated neighbors are expressed by neurons

    • 79% are involved in membrane signaling

    • 45% have published links to pain

Methodological approach for genetic studies:

  • Generate construct containing the entire sequence of Kcns1 with flanking loxP sites

  • Electroporate into mouse embryonic stem cells

  • Identify positive clones by Southern blotting and PCR

  • Generate founder lines and validate by genotyping

  • Cross with tissue-specific Cre lines for conditional deletion

  • Validate deletion by qPCR and Western blotting

What are the methodological challenges in studying Kcns1's role in neuronal excitability?

Several methodological challenges exist when investigating Kcns1 function:

  • Heteromerization requirements: Kcns1 must associate with Kcnb family members to form functional channels, making it difficult to isolate Kcns1-specific effects .

  • Lack of specific pharmacological tools: The high conservation within the Kv family makes it challenging to develop Kcns1-specific modulators. Researchers can overcome this by:

    • Using genetic approaches (siRNA, conditional knockouts)

    • Developing more selective antibodies or peptide inhibitors

    • Employing electrophysiological approaches that can distinguish heteromeric channels

  • Central versus peripheral effects: Robust expression of Kcns1 throughout the nervous system makes it difficult to distinguish between peripheral and central effects. Solutions include:

    • Using tissue-specific knockout models (e.g., DRG-specific deletion)

    • Employing local delivery of siRNAs or inhibitors

    • Conducting ex vivo recordings from isolated sensory neurons

  • Protein stability and production challenges: When producing recombinant Kcns1:

    • Expression of full-length protein may be challenging due to hydrophobic transmembrane domains

    • Protein solubility and proper folding must be verified

    • Purification protocols need optimization to maintain functional conformation

How can Kcns1 expression be quantified in experimental pain models?

Quantification of Kcns1 expression requires a multi-modal approach:

  • qRT-PCR methodology:

    • Harvest tissues (DRG, spinal cord) following ethical guidelines

    • Extract RNA using optimal preservation techniques

    • Perform reverse transcription with high-fidelity enzymes

    • Design primers specific to Kcns1 coding regions

    • Normalize to stable reference genes (avoid using single reference genes)

    • Use relative quantification with the 2^-ΔΔCt method

  • Western blot analysis:

    • Generate validated antibodies against Kcns1 (e.g., targeting the C-terminal region)

    • Test specificity using knockout tissues or shRNA knockdown controls

    • Optimize protein extraction from neuronal tissues

    • Separate proteins on SDS-PAGE and transfer to membranes

    • Probe with anti-Kcns1 antibody (1-2 μg/μL) followed by HRP-conjugated secondary antibody

    • Visualize using chemiluminescence and quantify band intensity

  • Immunohistochemical quantification:

    • Use objective criteria for positive cell identification

    • Measure intensity above background levels (≥3 standard deviations)

    • Count 100-200 DRG neurons and 50-100 motoneurons per animal

    • Only quantify cells with clearly visible nuclei

    • Use 25× objective for consistent magnification

What are the optimal behavioral assays to evaluate the effects of Kcns1 manipulation?

Based on research findings, the following behavioral assays are most relevant for Kcns1 studies:

Behavioral TestParameter MeasuredRelevance to Kcns1Methodological Notes
Von Frey testMechanical sensitivityKcns1 KO mice show increased mechanical painUse calibrated filaments; apply up-down testing method
Cold plantar testCold sensitivityKcns1 deletion increases cold hypersensitivityMeasure latency to withdraw from cold stimulus
Rotarod testMotor coordination/proprioceptionKcns1 deletion improves locomotor performanceMeasure latency to fall at increasing speeds
Spared nerve injury modelNeuropathic pain developmentKcns1 KO mice show exaggerated mechanical pain after nerve injuryAssess thresholds at multiple timepoints after injury

When designing these assays:

  • Establish proper baseline measurements before any manipulation

  • Include both male and female animals to account for sex differences

  • Blind the experimenter to genotype or treatment

  • Assess pain thresholds at multiple timepoints (uninduced baseline, after tamoxifen treatment, and days 7, 10, 14, and 21 after injury)

How can researchers develop functional assays to study Kcns1 channel properties?

Functional characterization of Kcns1 channels requires specialized electrophysiological approaches:

  • Heterologous expression systems:

    • Co-express Kcns1 with Kcnb family members in expression systems

    • Use patch-clamp recordings to assess:

      • Voltage-dependence of activation and inactivation

      • Kinetics of current activation/deactivation

      • Closed-state inactivation properties

    • Compare properties of homomeric Kcnb channels vs. Kcnb/Kcns1 heteromers

  • Primary neuronal cultures:

    • Isolate DRG neurons from wild-type and Kcns1 knockout animals

    • Perform whole-cell patch-clamp recordings

    • Characterize potassium currents using specific voltage protocols

    • Correlate electrophysiological properties with neuronal subtypes (identified by size, marker expression)

  • Ex vivo skin-nerve preparations:

    • Record from intact sensory fibers in their native environment

    • Compare mechanosensitivity and cold responses between genotypes

    • Correlate with behavioral findings on mechanical and cold hypersensitivity

What are common pitfalls in Kcns1 antibody production and validation?

Generating specific antibodies against Kcns1 presents several challenges:

  • Epitope selection:

    • Target unique regions of Kcns1 not conserved in other Kv channels

    • The C-terminal region (aa 469-497) has been successfully used for antibody generation

    • Avoid transmembrane domains which may have limited accessibility

  • Validation strategies:

    • Test on tissues from Kcns1 knockout animals (negative control)

    • Verify specificity using Western blot against recombinant protein

    • Perform peptide competition assays to confirm binding specificity

    • Test cross-reactivity with other Kv family members

  • Purification approach:

    • Express fusion proteins (e.g., GST-Kcns1 fragments)

    • Purify using glutathione-Sepharose 4B resin

    • Use affinity purification to isolate specific antibodies

    • Verify batch-to-batch consistency

How can researchers optimize recombinant Kcns1 protein production and stability?

For optimal recombinant Kcns1 production:

  • Expression system selection:

    • E. coli systems work well for partial fragments or soluble domains

    • Consider mammalian or insect cell systems for full-length membrane proteins

    • Optimize codon usage for the expression host

  • Tag selection and placement:

    • N-terminal His-tags are commonly used for purification

    • Consider the impact of tags on protein folding and function

    • Include protease cleavage sites if tag removal is necessary

  • Storage and stability optimization:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • Reconstitute in appropriate buffers (e.g., Tris/PBS-based buffer, pH 8.0)

    • Add stabilizers such as trehalose (6%) or glycerol (5-50%)

    • For long-term storage, lyophilization may improve stability

What are promising therapeutic approaches targeting Kcns1 for pain management?

Based on current understanding of Kcns1 function, several therapeutic approaches show promise:

  • Small molecule enhancers:

    • Develop compounds that enhance Kcns1/Kcnb heteromer function

    • Screen for molecules that stabilize closed-state inactivation

    • Focus on compounds that can cross the blood-brain barrier for CNS effects

  • Gene therapy approaches:

    • Viral vector-mediated delivery of Kcns1 to sensory neurons

    • CRISPR-based strategies to correct pain-associated polymorphisms

    • Targeted upregulation of endogenous Kcns1 expression

  • Combination therapies:

    • Pair Kcns1-targeting approaches with existing pain medications

    • Target multiple ion channels involved in neuronal hyperexcitability

    • Develop tissue-specific delivery systems to minimize side effects

Research findings suggest that "restoring Kcns1 function in the periphery may be of some use in ameliorating mechanical and cold pain in chronic states" and "compounds that enhance Kcns1 activity may provide analgesia" .

How might systems biology approaches advance our understanding of Kcns1 in pain circuits?

Systems biology offers powerful tools to contextualize Kcns1 function within broader pain signaling networks:

  • Network analysis approaches:

    • Expand on existing network analyses showing co-regulation of Kcns1 with other pain-related genes

    • Identify potential transcriptional regulators of Kcns1 expression

    • Map protein-protein interaction networks involving Kcns1 and Kcnb family members

  • Single-cell transcriptomics:

    • Characterize cell-type specific expression patterns of Kcns1

    • Identify neuronal subtypes most dependent on Kcns1 function

    • Map transcriptional changes in Kcns1-expressing neurons following injury

  • Computational modeling:

    • Develop biophysical models of Kcns1/Kcnb heteromer function

    • Simulate effects of Kcns1 modulation on neuronal excitability

    • Predict optimal therapeutic interventions based on model outputs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.