Recombinant Rat Potassium voltage-gated channel subfamily S member 2 (Kcns2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you require a specific format, please specify your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specifications.
Synonyms
Kcns2; Potassium voltage-gated channel subfamily S member 2; Delayed-rectifier K(+ channel alpha subunit 2; Voltage-gated potassium channel subunit Kv9.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-477
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcns2
Target Protein Sequence
MTRQSLWDLSETDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCD DYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCS YSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNP GYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGNPGEDPRFEIVEHFGIAWFTF ELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESSPTLANLGRVAQVLRLM RIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLAT IPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ KQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLDDSLH
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It can form functional heterotetrameric channels with KCNB1 and KCNB2, modulating the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 and KCNB2.
Database Links
Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.2/KCNS2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain, lung and in pulmonary arteries.

Q&A

What is the molecular structure and classification of Rat Kcns2?

Rat Kcns2 (also known as Kv9.2) is a voltage-gated potassium channel subunit that belongs to the B subfamily of potassium channels. Unlike some potassium channels that form functional homotetramers, Kcns2 primarily functions as a modulatory subunit that assembles with other Kv channel subunits, particularly Kv2 family members. The protein is characterized as a six transmembrane glycoprotein with a molecular weight range of 65-70 kDa .

Methodologically, researchers should note that Kcns2 is classified within the larger voltage-gated potassium channel superfamily that includes:

Channel FamilyPrimary FunctionTypical Tetramer Formation
Kv1 (Shaker-related)Action potential repolarizationHomotetrameric
Kv2 (Shab-related)Delayed rectifier functionHomo and heterotretrameric
Kv3 (Shaw-related)High-threshold, fast-gatingPrimarily homotetrameric
Kv9 (Modifier subunits)Regulatory/modulatoryHeterotretrameric only

Experimental approaches for studying Kcns2 structure should consider its natural heteromeric assembly with Kv2 family members rather than isolated expression systems .

How does Kcns2 function differ from other potassium channel subunits?

Unlike Kv2.1 and Kv2.2 subunits which can form functional homotetrameric channels independently, Kcns2 functions as a modulatory subunit that does not form functional homomeric channels. Instead, it associates with Kv2 family members to modify their biophysical properties, including activation/inactivation kinetics and voltage dependence.

Methodologically, researchers should employ:

  • Heterologous co-expression systems (typically HEK293 or Xenopus oocytes) where Kcns2 is expressed together with Kv2.1 or Kv2.2

  • Patch-clamp electrophysiology to measure altered channel kinetics

  • Voltage protocols specifically designed to detect changes in activation threshold, inactivation rates, and deactivation kinetics

The experimental evidence indicates that Kcns2 co-assembly with Kv2 channels typically results in:

When designing experiments, it's important to consider that physiological function of Kcns2 is primarily observed through these heteromeric interactions rather than as an independent channel entity .

What are the expression patterns of Kcns2 in rat tissues?

Kcns2 shows a distinctive expression pattern predominantly in the nervous system, with highest expression in specific neuronal populations. Methodologically, researchers have determined tissue distribution through:

  • RT-PCR and qPCR for mRNA quantification

  • Western blotting for protein detection

  • Immunohistochemistry for cellular localization

  • In situ hybridization for tissue-specific expression

Expression data for rat Kcns2 across tissues reveals:

TissueRelative Expression LevelDetection Method
Brain (general)HighRT-PCR, Western blot
NeocortexHighIn situ hybridization
HippocampusModerateImmunohistochemistry
Retinal ganglion cellsHighIn situ hybridization
Peripheral neuronsModerateRT-PCR
HeartLow/MinimalRT-PCR
Smooth muscleLowWestern blot
LiverMinimal/Not detectedRT-PCR

For accurate expression analysis, researchers should employ multiple detection methods as antibody specificity can be a limitation. Western blot analysis typically reveals bands at 65-70 kDa for the Kcns2 protein .

What are the most effective methods for producing recombinant Rat Kcns2 protein?

Producing recombinant Rat Kcns2 protein requires specialized approaches due to the membrane-bound nature of potassium channels. The following methodological workflow has proven effective:

  • Gene Cloning:

    • Isolate total RNA from rat brain tissue

    • Perform RT-PCR with Kcns2-specific primers

    • Clone the full-length cDNA (561 bp encoding 187 amino acids) into appropriate expression vectors

    • Verify sequence integrity through Sanger sequencing

  • Expression Systems:

    • For functional studies: Mammalian cell lines (HEK293, CHO) or Xenopus oocytes

    • For protein production: Insect cell systems (Sf9, High Five) with baculovirus vectors

    • For structural studies: Yeast expression systems (Pichia pastoris)

  • Protein Purification:

    • Solubilize membrane fractions with mild detergents (DDM, LMNG)

    • Employ affinity chromatography (typically His-tag or FLAG-tag based)

    • Further purify using size-exclusion chromatography

  • Verification:

    • Western blot with Kcns2-specific antibodies

    • Mass spectrometry for protein identification

    • Circular dichroism to confirm proper folding

Researchers should note that heterologous expression often yields better results when Kcns2 is co-expressed with Kv2 family members due to natural heteromeric assembly. For electrophysiological studies, expression in Xenopus oocytes typically provides robust currents when co-expressed with Kv2.1 or Kv2.2 .

How can RNA interference be effectively used to study Kcns2 function in rat models?

RNA interference provides a powerful approach for studying Kcns2 function through targeted gene silencing. The methodological approach involves:

  • shRNA Design:

    • Design multiple shRNA constructs (typically 4-5) targeting different regions of Kcns2 mRNA

    • Ensure specificity through BLAST analysis against rat genome

    • Include appropriate controls (scrambled sequences)

  • Delivery Methods:

    • In vitro: Transfection of primary neurons or cell lines using lipid-based reagents

    • Ex vivo: Electroporation of brain slices

    • In vivo: Viral vectors (AAV or lentivirus) for stereotactic delivery

  • Validation of Knockdown:

    • qRT-PCR for mRNA quantification (target: >70% reduction)

    • Western blot for protein reduction

    • Electrophysiological confirmation of functional changes

  • Experimental Timeline:

    • Peak knockdown typically occurs 48-72 hours post-transfection in vitro

    • For viral delivery in vivo, allow 2-3 weeks for optimal expression

Researchers should be aware that commercially available Kcns2 rat shRNA plasmids (such as those from OriGene, product TR710939) include four unique 29mer shRNA constructs in retroviral untagged vectors, providing multiple options for targeting different regions of the transcript .

When studying neuronal excitability, combine knockdown with patch-clamp electrophysiology to measure changes in:

  • Resting membrane potential

  • Action potential threshold

  • Afterhyperpolarization duration

  • Spike frequency adaptation

What are the optimal antibody-based methods for detecting Rat Kcns2 protein?

Detection of Rat Kcns2 protein requires careful selection of antibodies and optimization of protocols. The following methodological approaches are recommended:

  • Western Blot:

    • Sample preparation: Use RIPA buffer with protease inhibitors

    • Protein loading: 30-50μg total protein per lane

    • Gel percentage: 8-10% SDS-PAGE for optimal separation

    • Transfer conditions: Wet transfer at 30V overnight at 4°C

    • Blocking: 5% non-fat milk in TBST (1 hour at room temperature)

    • Primary antibody dilution: 1:500-1:2000 (verify with specific antibody datasheet)

    • Expected molecular weight: 65-70 kDa

  • Immunohistochemistry/Immunofluorescence:

    • Fixation: 4% paraformaldehyde (10-15 minutes)

    • Antigen retrieval: TE buffer pH 9.0 (recommended for many Kv channel antibodies)

    • Blocking: 10% normal serum + 0.3% Triton X-100 (1 hour)

    • Primary antibody dilution: 1:20-1:200

    • Incubation: Overnight at 4°C

    • Visualization: Fluorescent secondary antibodies or HRP/DAB system

  • Immunoprecipitation:

    • Lysate preparation: 1.0-3.0 mg total protein

    • Antibody amount: 0.5-4.0 μg per IP reaction

    • Pre-clearing: Protein A/G beads (1 hour)

    • Antibody incubation: Overnight at 4°C

    • Washes: 4-5 times with IP buffer containing reduced detergent

When selecting antibodies, researchers should verify cross-reactivity with rat Kcns2 and consider validation methods including positive controls (brain tissue) and specificity controls (peptide blocking or knockout validation) .

How does heteromeric assembly of Kcns2 with other Kv subunits affect channel function?

The heteromeric assembly of Kcns2 with other Kv subunits, particularly Kv2.1 and Kv2.2, results in channels with modified biophysical properties. Methodologically, researchers investigating these interactions should:

  • Co-expression Systems:

    • Express Kcns2 with Kv2.1 or Kv2.2 in heterologous systems

    • Utilize variable ratios of expression plasmids (1:1, 1:3, 3:1)

    • Include fluorescent tags (e.g., GFP, mCherry) on different subunits to confirm co-expression

  • Biophysical Characterization:

    • Employ voltage-clamp protocols that evaluate:

      • Voltage-dependent activation (V₁/₂)

      • Inactivation kinetics

      • Deactivation rates

      • Single-channel conductance

  • Stoichiometry Analysis:

    • Use single-molecule fluorescence approaches

    • Implement FRET techniques between tagged subunits

    • Apply biochemical crosslinking followed by mass spectrometry

Research data shows that Kcns2 co-expression typically modifies Kv2 channels in the following ways:

ParameterKv2.1 HomomericKv2.1+Kcns2 HeteromericFunctional Impact
Activation V₁/₂-5 to 0 mV-15 to -10 mVHyperpolarizing shift
Activation kineticsτ = 5-10 msτ = 15-20 msSlower activation
Deactivation rateFastSignificantly slowerProlonged repolarization
Current amplitudeLargeReduced by 30-50%Decreased K⁺ conductance
Single channel conductance~10 pS~8 pSSlightly reduced

The functional consequence is that neurons expressing Kcns2+Kv2 heteromers typically show altered excitability patterns compared to those expressing only Kv2 homomers, including modified action potential repolarization and firing frequencies .

What are the roles of Kcns2 in neuronal excitability and what experimental approaches best demonstrate these functions?

Kcns2 plays important roles in regulating neuronal excitability, primarily through its modulation of Kv2 channels. To investigate these functions, researchers should implement the following methodological approaches:

  • Electrophysiological Characterization:

    • Whole-cell patch-clamp recordings in:

      • Acutely dissociated neurons

      • Brain slice preparations

      • Cultured primary neurons

    • Current-clamp protocols to assess:

      • Action potential waveform

      • Firing frequency

      • Afterhyperpolarization (AHP) amplitude and duration

      • Spike frequency adaptation

  • Genetic Manipulation Approaches:

    • Targeted knockdown using shRNA

    • Overexpression using viral vectors

    • CRISPR/Cas9-mediated gene editing

    • Transgenic rat models with conditional expression

  • Pharmacological Approaches:

    • Application of Kv channel modulators (retigabine, XE991)

    • Comparison of effects in Kcns2-depleted vs. control neurons

Research findings demonstrate that Kcns2 contributes to neuronal function in several ways:

Neuronal FunctionKcns2 ContributionExperimental Evidence
Resting membrane potentialMinimal direct effectNo significant RMP changes in soma with Kv7 modulators
Action potential repolarizationModerate contributionModified AP width with Kcns2 manipulation
AfterhyperpolarizationSubstantial role30-40% of IM conductance affects AHP duration
Spike frequency adaptationMajor contributionAltered firing patterns with Kcns2 manipulation
Neuronal excitability thresholdsSignificant modulationChanges in firing threshold and frequency

Recent research indicates that Kcns2 participates in non-opioid analgesic mechanisms, as demonstrated by vHCA8 gene therapy producing Kv7 channel activation, which decreases neuronal excitability in nociceptors . These findings suggest therapeutic potential for modulating Kcns2 function in pain management.

What are the challenges in distinguishing Kcns2 function from other potassium channel subfamily members in experimental models?

Distinguishing the specific functions of Kcns2 from other potassium channel subfamily members presents significant experimental challenges. Researchers should consider the following methodological approaches to address these issues:

  • Specificity Challenges:

    • Sequence homology between potassium channel subfamilies

    • Overlapping expression patterns

    • Functional redundancy

    • Limited availability of subtype-specific pharmacological tools

  • Experimental Solutions:

    • Molecular Approaches:

      • Gene-specific knockdown using validated shRNA constructs

      • CRISPR/Cas9-mediated precise gene editing

      • Subunit-specific dominant negative constructs

      • Epitope tagging for specific detection

    • Pharmacological Approaches:

      • When directly comparing channel subtypes, establish dose-response relationships

      • Use multiple structurally distinct compounds targeting the same channel

      • Employ combination approaches (genetic manipulation + pharmacology)

    • Electrophysiological Approaches:

      • Design voltage protocols that distinguish channel subtypes based on biophysical properties

      • Use channel kinetics to separate currents (activation/inactivation/deactivation rates)

      • Single-channel recording to identify conductance differences

  • Controls and Validation:

    • Include experiments in heterologous systems with defined subunit composition

    • Validate findings across multiple experimental approaches

    • Use computational modeling to predict and test subtype-specific effects

Comparative analysis of potassium channel subtypes reveals distinctive properties that can aid in experimental distinction:

Channel TypeActivation ThresholdInactivationPharmacological ToolsKey Experimental Approach
Kv2.1-20 to 0 mVSlowGuangxitoxinBiophysical profiling
Kv2.2-20 to 0 mVSlowNone specificGenetic manipulation
Kcns2 (with Kv2)-30 to -10 mVModifiedNone specificCo-expression studies
Kv7 (KCNQ)-60 to -40 mVVery slowRetigabine, XE991Pharmacological isolation
Kir2 (KCNJ2)Constitutively activeNoneBarium (nonspecific)Voltage-dependent block

A key finding from recent research is that neurons from different parts of the brain show varied sensitivity to potassium channel modulators, suggesting region-specific expression patterns and functional roles. For example, the intensity of Kv3.1 immunoreactivity varied across the tonotopic map in the medial nucleus of the trapezoid body, with neurons responding best to high-frequency tones showing the most intense labeling .

How do genetic modifications of Kcns2 impact broader physiological functions in rat models?

Genetic modifications of Kcns2 can have diverse physiological impacts beyond individual cellular effects. Researchers investigating these broader impacts should implement the following methodological approaches:

  • Gene Manipulation Strategies:

    • Knockdown approaches:

      • shRNA-mediated transient knockdown

      • Antisense oligonucleotides

    • Knockout approaches:

      • CRISPR/Cas9-mediated gene deletion

      • Conditional knockout using Cre-loxP systems

    • Overexpression models:

      • Viral vector-mediated gene delivery

      • Transgenic overexpression

  • Physiological Assessment:

    • Neuronal Network Function:

      • In vivo electrophysiology (single unit and field potentials)

      • EEG recordings for network synchronization

      • Calcium imaging in neuronal populations

    • Behavioral Assessment:

      • Sensory processing (auditory, visual, somatosensory)

      • Motor coordination and function

      • Learning and memory paradigms

      • Nociception and pain response

  • Molecular and Biochemical Analysis:

    • Transcriptome analysis (RNA-seq) to identify compensatory changes

    • Proteomics to detect alterations in channel complexes

    • Phosphorylation status of channel proteins

Research findings indicate that Kcns2 modifications have significant physiological impacts:

Physiological SystemImpact of Kcns2 ModificationExperimental Evidence
Auditory processingAltered firing patterns in auditory neuronsVaried expression of related Kv3 channels across auditory pathways
NociceptionDecreased neuronal excitability in nociceptorsKv7 channel activation via gene therapy reduces pain signals
Neuronal excitabilityModulation of firing patternsDifferential Kcns2 expression correlates with excitability parameters
Alcohol consumption behaviorCorrelation with voluntary drinkingKv7 channel transcripts negatively covary with ethanol consumption

Recent research has shown that potassium channel gene expression, including Kcns2-related channels, correlates with complex behaviors such as alcohol consumption. For example, transcripts encoding Kv7 channels show negative covariation with drinking behaviors in non-dependent BXD mouse strains, and pharmacological modulation of these channels with retigabine significantly reduces voluntary ethanol consumption .

What are the newest techniques for studying Kcns2 interactions with the cellular proteome?

Emerging technologies have expanded our ability to study Kcns2 interactions with cellular proteins. Researchers exploring these interactions should consider the following methodological approaches:

  • Advanced Interaction Proteomics:

    • Proximity-based labeling:

      • BioID or TurboID fusion proteins

      • APEX2-based proximity labeling

      • Protocol: Express Kcns2-BioID fusion in neurons, add biotin, purify biotinylated proteins, and identify by mass spectrometry

    • Cross-linking Mass Spectrometry (XL-MS):

      • Chemical crosslinking of protein complexes in native conditions

      • MS/MS analysis to identify crosslinked peptides

      • Computational modeling of interaction interfaces

    • Co-immunoprecipitation with Quantitative Proteomics:

      • SILAC or TMT labeling for quantitative comparison

      • Protocol: Immunoprecipitate Kcns2 from different conditions, quantify interacting partners

  • Live-cell Interaction Visualization:

    • FRET-based approaches:

      • Kcns2-CFP and potential partner-YFP fusions

      • Measure FRET efficiency in various cellular compartments

    • Split-fluorescent protein complementation:

      • Kcns2-GFP11 and partner-GFP1-10 constructs

      • Visualize interactions through fluorescence restoration

  • Single-molecule Tracking:

    • PALM/STORM super-resolution microscopy

    • Quantum dot labeling of Kcns2 for long-term tracking

    • Analysis of diffusion coefficients and confinement zones

Recent studies have begun to reveal Kcns2's interactome, which includes not only other potassium channel subunits but also regulatory proteins, trafficking molecules, and cytoskeletal elements. Understanding these interactions is crucial for developing targeted therapeutics that modulate Kcns2 function without affecting related channels .

How can integrated experimental designs incorporate Kcns2 studies into long-term toxicology and developmental models?

Incorporating Kcns2 studies into integrated long-term toxicology and developmental models allows for comprehensive assessment of channel function across multiple physiological contexts. Researchers should consider the following methodological approaches:

  • Integrated Study Design:

    • Developmental Timeline:

      • Expose animals from fetal life (GD12) through adulthood (104 weeks)

      • Include interim evaluations at key developmental milestones

      • Follow the Ramazzini Institute integrated experimental design

    • Multi-endpoint Assessment:

      • Molecular: Kcns2 expression and modification

      • Cellular: Electrophysiological properties

      • Tissue: Histopathology and morphology

      • Organismal: Behavioral and physiological parameters

  • Windows of Susceptibility (WOS) Analysis:

    • Study Kcns2 function during critical developmental periods:

      • Prenatal neurogenesis and channel expression

      • Neonatal circuit formation

      • Pubertal maturation of excitability

      • Adult maintenance and aging-related changes

    • Compare effects of toxicant exposure across these windows

  • Toxicological Assessment:

    • Evaluate how environmental toxicants affect Kcns2:

      • Expression levels (mRNA and protein)

      • Trafficking and membrane localization

      • Channel kinetics and biophysical properties

      • Interaction with regulatory proteins

The integrated approach should incorporate multiple assessment techniques as outlined in this table:

Assessment PeriodKcns2-specific EndpointsGeneral AssessmentsMethodological Approach
Prenatal (GD12-birth)Expression onset patternsDevelopmental milestonesIn situ hybridization, RT-PCR
Neonatal (PND1-28)Channel localizationReflex development, growthImmunohistochemistry, electrophysiology
Juvenile (PND29-60)Functional maturationBehavioral developmentPatch-clamp, behavioral testing
Adult (>PND60)Stable expression patternsPhysiological functionMulti-electrode arrays, proteomics
Aging (>104 weeks)Age-related changesDegenerative processesComparative expression analysis

This integrated approach aligns with the 3Rs principle (replacement, reduction, and refinement) by maximizing the information gained from each experimental animal while reducing the total number required for comprehensive assessment .

What are the common challenges in Kcns2 expression systems and how can they be overcome?

Recombinant expression of Kcns2 presents several technical challenges that researchers must address to obtain reliable results. The following methodological approaches help overcome these obstacles:

  • Expression Level Issues:

    • Challenge: Low expression levels in heterologous systems

    • Solutions:

      • Optimize codon usage for expression system

      • Use strong promoters (CMV for mammalian cells, polyhedrin for insect cells)

      • Include Kozak consensus sequence for efficient translation

      • Co-express with Kv2 family members for better stability

  • Protein Misfolding/Trafficking:

    • Challenge: Retention in ER, improper folding

    • Solutions:

      • Culture cells at lower temperature (30°C instead of 37°C)

      • Add chemical chaperones (glycerol, DMSO at low concentrations)

      • Co-express with chaperone proteins

      • Include trafficking signals or remove retention signals

  • Functional Assessment Difficulties:

    • Challenge: Limited function as homomeric channels

    • Solutions:

      • Always co-express with Kv2.1 or Kv2.2

      • Use optimized molar ratios (typically 1:1 to 1:3 Kcns2:Kv2)

      • Design electrophysiological protocols specifically for heteromeric channels

      • Include positive controls (Kv2.1 alone) in all experiments

  • Antibody Specificity Issues:

    • Challenge: Cross-reactivity with related potassium channels

    • Solutions:

      • Validate antibodies using knockout/knockdown controls

      • Use epitope tags (FLAG, HA, V5) for specific detection

      • Employ peptide competition assays to confirm specificity

      • Validate across multiple detection methods

Quality control checkpoints should be implemented at each stage:

Expression StageQuality Control MethodAcceptance Criteria
Plasmid preparationSequence verification100% sequence match to reference
TransfectionGFP reporter co-transfection>70% transfection efficiency
Protein expressionWestern blotClear band at 65-70 kDa
Membrane localizationSurface biotinylation>30% of total protein at surface
Functional assessmentWhole-cell patch clampModified currents compared to Kv2 alone

By implementing these methodological solutions and quality control measures, researchers can significantly improve the reliability and reproducibility of Kcns2 studies in heterologous expression systems .

How can researchers validate the specificity of genetic manipulations targeting Kcns2?

Ensuring specificity in genetic manipulations of Kcns2 is critical for accurate interpretation of experimental results. Researchers should implement comprehensive validation strategies:

  • shRNA/siRNA Validation:

    • Off-target Effect Assessment:

      • Bioinformatic prediction of potential off-targets

      • Test multiple constructs targeting different regions

      • Include scrambled and non-targeting controls

    • Knockdown Validation:

      • qRT-PCR for target mRNA (expect >70% reduction)

      • Western blot for protein reduction

      • Rescue experiments with RNAi-resistant constructs

      • Assess related channel expression to confirm specificity

  • CRISPR/Cas9 Validation:

    • Guide RNA Design Validation:

      • Multiple computational tools for off-target prediction

      • Use high-fidelity Cas9 variants

      • Validate editing efficiency by sequencing

    • Functional Validation:

      • Genomic sequencing to confirm intended modifications

      • Off-target analysis of top predicted sites

      • Whole-transcriptome analysis to detect compensatory changes

      • Phenotypic comparison with alternative knockout methods

  • Transgenic Overexpression Validation:

    • Expression Level Control:

      • Quantitative comparison to endogenous levels

      • Use of inducible promoters to titrate expression

      • Tissue-specific promoters for targeted expression

    • Functional Impact Assessment:

      • Electrophysiological verification of expected changes

      • Comparison with pharmacological approaches

      • Reversibility testing with inducible systems

The validation workflow should include multiple approaches:

Validation LevelTechniqueExpected Outcome
GenomicPCR and sequencingConfirmation of intended modification
TranscriptqRT-PCR, RNA-seqTarget-specific changes without global disruption
ProteinWestern blot, immunostainingSpecific reduction/increase in target protein
ElectrophysiologicalPatch-clampFunction consistent with molecular changes
BehavioralSpecific assays based on channel functionPhenotype consistent with channel role

When using commercially available shRNA constructs, such as the Kcns2 Rat shRNA Plasmid (Locus ID 66022) from OriGene (TR710939), researchers should test all four provided constructs to identify the most effective and specific option for their experimental system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.