Recombinant Rat Potassium voltage-gated channel subfamily S member 3 (Kcns3)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Profile of Kcns3

Kcns3 encodes a voltage-gated potassium channel modulatory α-subunit (Kv9.3) that coassembles with functional α-subunits like KCNB1 (Kv2.1) to form heterotetrameric delayed-rectifier potassium channels . Key features include:

  • Non-functional alone: Requires coassembly with Kv2.1/Kv2.2 subunits to modify channel kinetics .

  • Functional impact: Shifts activation thresholds toward more negative potentials and enhances current amplitude in hypoxic conditions .

  • Selective expression: Enriched in parvalbumin (PV)-containing GABAergic neurons in the prefrontal cortex (PFC) .

Table 1: Recombinant Kcns3 Variants and Expression Systems

Host SystemPurityTagSpeciesSource
Cell-Free Expression≥85%NoneRatMyBioSource
E. coli≥85%His, GSTMouse*Creative BioMart
Mammalian Cells≥90%HisMouse*Creative BioMart

*Mouse Kcns3 shares 97% amino acid identity with Rat Kcns3, enabling cross-species functional studies .

Neurological Studies

  • PV neuron physiology: Recombinant Kcns3 is critical for studying PV neuron dysfunction in schizophrenia. Kcns3-deficient mice exhibit irregular spike patterns and impaired gamma-frequency oscillations, mirroring deficits observed in schizophrenia .

  • Channel modulation: Coexpression with Kv2.1 in vitro reveals accelerated activation/deactivation kinetics, providing insights into synaptic integration .

Table 2: Key Pathways Involving Kcns3

PathwayAssociated Proteins
Regulation of Insulin SecretionKCNB1, SYT5, ARL2BP
Neuronal SystemSYN1, CACNG2B, AKAP5
Voltage-Gated Potassium ChannelsKCNC1, KCNH1, KCNQ3

Challenges and Future Directions

  • Expression optimization: Low yield in prokaryotic systems (e.g., E. coli) necessitates mammalian or insect cell systems for post-translational modifications .

  • Therapeutic potential: Kv9.3 subunits are proposed targets for correcting PV neuron excitability in neuropsychiatric disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
Kcns3; Potassium voltage-gated channel subfamily S member 3; Delayed-rectifier K(+ channel alpha subunit 3; Voltage-gated potassium channel subunit Kv9.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcns3
Target Protein Sequence
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSSR YQERKEESHEKDWDQKSNDVSTDSSFEESSLFEKELEKFDELRFGQLRKKIWIRMENPAY CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAIR LVAAPSQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDELASSLTSIPIC WWWATISMTTVGYGDTHPVTLAGKIIASTCIICGILVVALPITIIFNKFSKYYQKQKDMD VDQCSEDPPEKCHELPYFNIRDVYAQQVHAFITSLSSIGIVVSDPDSTDASSVEDNEDAY NTASLENCTAK
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It can form functional heterotetrameric channels with KCNB1, modulating the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1. Heterotetrameric channel activity formed with KCNB1 exhibits increased current amplitude, with the threshold for action potential activation shifted towards more negative values in hypoxic-treated pulmonary artery smooth muscle cells.
Database Links
Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.3/KCNS3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in myocytes. Detected in lung, spleen, brain and heart.

Q&A

What is Kcns3 and what is its primary function in neuronal systems?

Kcns3 (Potassium voltage-gated channel subfamily S member 3) is a modulatory potassium channel subunit that does not form functional homomeric channels but instead associates with members of the Kv2 family, particularly KCNB1 (Kv2.1), to form heteromeric channels. These heteromeric channels modify the biophysical properties of Kv2 channels, influencing neuronal excitability and action potential characteristics.

When Kcns3 associates with Kv2.1 channels, it typically causes a hyperpolarizing shift in the activation curve, accelerates activation kinetics, and slows deactivation. This modulation plays a crucial role in regulating neuronal firing patterns, particularly in cortical neurons where Kcns3 is abundantly expressed .

How is Kcns3 expression distributed in the rat central nervous system?

Kcns3 shows a specific distribution pattern in the rat brain, with particularly high expression in:

  • Cortical regions, especially in layers 2-6 of the neocortex

  • Hippocampal formation

  • Certain thalamic nuclei

  • Cerebellar Purkinje cells

Within these regions, Kcns3 expression is primarily neuronal and shows cell-type specificity. The distribution pattern suggests that Kcns3 plays important roles in circuits involved in cognitive processes, sensory integration, and motor control.

For researchers investigating Kcns3 localization, in situ hybridization techniques using specific riboprobes have been most effectively employed to characterize the expression patterns at the mRNA level . For protein-level analysis, immunohistochemistry with validated antibodies against Kcns3 can be utilized, though care must be taken to verify antibody specificity.

How does Kcns3 interact with other Kv channel subunits?

Kcns3 belongs to the electrically silent Kv channel subunits that do not form functional homomeric channels but instead modify the properties of Kv2 family members through heteromeric assembly. The primary interaction partner is Kv2.1 (KCNB1), and the resulting heteromeric channels exhibit distinct biophysical properties:

  • Hyperpolarized voltage-dependence of activation

  • Accelerated activation kinetics

  • Slowed deactivation kinetics

  • Altered sensitivity to pharmacological agents

The interaction occurs through the T1 domain in the N-terminal region, which is involved in subfamily-specific assembly of Kv channels. For experimental analysis of these interactions, techniques such as co-immunoprecipitation, FRET (Fluorescence Resonance Energy Transfer), and electrophysiological characterization of co-expressed subunits in heterologous expression systems are most commonly employed.

What are the established methods for recombinant expression of rat Kcns3?

For successful recombinant expression of rat Kcns3, researchers typically employ the following methodological approaches:

Expression Systems:

  • Mammalian cell lines (HEK293, CHO cells) for functional studies

  • Xenopus laevis oocytes for electrophysiological characterization

  • Insect cells (Sf9, High Five) with baculovirus vectors for protein production

Expression Vectors:

  • pCDNA3.1 for mammalian expression

  • pGEMHE for oocyte expression

  • pFastBac for baculovirus expression

Optimization Strategies:

  • Codon optimization for the expression system

  • Addition of epitope tags (His, FLAG, HA) for detection and purification

  • Co-expression with Kv2.1 for functional studies

  • Temperature reduction during expression to improve protein folding

When expressing Kcns3 for functional studies, it is essential to co-express it with Kv2.1 since Kcns3 alone does not form functional channels. For biochemical and structural studies, expression can be optimized by using stronger promoters and including molecular chaperones to enhance proper folding.

How does oxidative modification of Kcns3-containing channels affect neuronal excitability and survival?

While direct evidence regarding oxidative modification of Kcns3 is limited, studies on its primary interaction partner, KCNB1 (Kv2.1), provide valuable insights into how Kcns3-containing heteromeric channels might be affected by oxidative stress.

KCNB1 channels undergo oxidation-induced conformational changes that can trigger apoptotic signaling pathways. Specifically, oxidative stress leads to:

  • Formation of disulfide bonds between KCNB1 subunits, creating oligomers

  • Increased channel insertion into the plasma membrane

  • Altered channel kinetics and voltage-dependence

  • Activation of pro-apoptotic signaling cascades

These oxidative modifications of KCNB1 have been implicated in neuronal apoptosis during aging and in neurodegenerative conditions . The presence of Kcns3 in heteromeric channels may modulate these responses to oxidative stress, potentially altering the threshold for apoptotic signaling.

When investigating oxidative modifications, researchers should consider:

  • Using site-directed mutagenesis to identify critical cysteine residues involved in oxidation

  • Employing non-reducing SDS-PAGE to detect oligomer formation

  • Applying patch-clamp techniques to characterize functional alterations

  • Utilizing redox proteomics approaches to identify specific modifications

What is the relationship between Kcns3 expression alterations and psychiatric disorders?

Research has identified altered expression of KCNS3 in psychiatric disorders, particularly schizophrenia. In postmortem studies of human brain tissue, KCNS3 mRNA levels were found to be lower in the prefrontal cortex of individuals with schizophrenia compared to matched controls .

This reduction may contribute to the pathophysiology of schizophrenia through:

  • Altered cortical excitability due to changes in Kv2.1/Kcns3 heteromeric channel function

  • Disrupted synchronization of neuronal networks

  • Compromised inhibitory circuit function

  • Potential compensatory changes in other ion channels

For researchers investigating Kcns3 in psychiatric disorders, methodological considerations include:

  • Using in situ hybridization with specific riboprobes to quantify mRNA expression levels

  • Employing qPCR for broader tissue analysis

  • Conducting paired analyses between case and control samples

  • Controlling for potential confounding factors (medication history, postmortem interval, etc.)

  • Correlating expression changes with clinical and cognitive measures

How can the electrophysiological properties of heteromeric Kv2.1/Kcns3 channels be distinguished from homomeric Kv2.1 channels?

Distinguishing heteromeric Kv2.1/Kcns3 channels from homomeric Kv2.1 channels requires careful electrophysiological characterization. Key distinguishing features include:

Voltage-Dependence Parameters:

ParameterHomomeric Kv2.1Heteromeric Kv2.1/Kcns3
V₁/₂ Activation~0 mV~-20 mV (hyperpolarized)
Activation time constantSlowerFaster
Deactivation time constantFasterSlower
Inactivation propertiesMinimalEnhanced

Pharmacological Profile:

AgentEffect on Kv2.1Effect on Kv2.1/Kcns3
TEAHigh sensitivityReduced sensitivity
4-APModerate blockAltered sensitivity
GuangxitoxinHigh affinityModified affinity

For rigorous characterization, researchers should:

  • Express defined ratios of Kv2.1 and Kcns3 in heterologous systems

  • Use whole-cell patch-clamp recording with standardized voltage protocols

  • Apply pharmacological agents at multiple concentrations to generate dose-response curves

  • Consider single-channel recordings to detect changes in channel conductance and open probability

  • Implement temperature controls, as channel kinetics are temperature-dependent

What are the current approaches for studying Kcns3 trafficking and membrane localization?

Investigating Kcns3 trafficking and membrane localization requires specialized techniques to overcome challenges associated with the silent nature of Kcns3 homomers. Current methodological approaches include:

Imaging Techniques:

  • Fluorescent protein tagging (GFP, mCherry) of Kcns3 with careful validation that tags don't disrupt trafficking

  • Super-resolution microscopy (STORM, PALM) to visualize channel clustering

  • FRAP (Fluorescence Recovery After Photobleaching) to assess membrane mobility

  • Live-cell imaging to monitor dynamic trafficking events

Biochemical Approaches:

  • Surface biotinylation assays to quantify membrane-inserted channels

  • Subcellular fractionation to determine distribution in cellular compartments

  • Protease protection assays to assess topology

  • Co-immunoprecipitation to identify interacting proteins involved in trafficking

Molecular Tools:

  • Generation of trafficking mutants through structure-guided mutagenesis

  • Dominant-negative constructs to disrupt specific trafficking pathways

  • Endocytic and secretory pathway markers for colocalization studies

  • RUSH (Retention Using Selective Hooks) system for synchronized trafficking studies

When studying Kcns3 trafficking, it's essential to consider its obligate heteromeric assembly with Kv2.1, as this interaction likely governs many aspects of Kcns3 localization and surface expression.

What are the optimal conditions for electrophysiological characterization of recombinant Kcns3-containing channels?

For robust electrophysiological analysis of Kcns3-containing channels, researchers should consider the following methodological parameters:

Expression System Selection:

  • Mammalian cell lines (HEK293, CHO) provide physiological membrane composition and processing

  • Xenopus oocytes allow for robust expression and stable recordings

  • Primary neuronal cultures can be transfected for more physiologically relevant context

Recording Configuration:

  • Whole-cell patch clamp for macroscopic current characterization

  • Outside-out patches for pharmacological studies

  • Cell-attached patches for examining channel regulation by intracellular signaling

Recording Solutions:

CompartmentCompositionRationale
Extracellular135-145 mM NaCl, 5 mM KCl, 2 mM CaCl₂, 1 mM MgCl₂, 10 mM HEPES, pH 7.4Physiological ionic conditions
Intracellular130-140 mM KCl or K-gluconate, 5-10 mM EGTA, 5 mM MgATP, 0.3 mM Na₂GTP, 10 mM HEPES, pH 7.2Maintains physiological intracellular milieu

Voltage Protocols:

  • Activation: Holding at -80 mV with steps from -100 to +60 mV

  • Deactivation: Prepulse to +40 mV followed by steps to various negative potentials

  • Inactivation: Holding at -80 mV with variable prepulses followed by test pulse to +40 mV

  • Recovery from inactivation: Two-pulse protocol with variable interpulse interval

Data Analysis Considerations:

  • Leak subtraction using P/4 or P/8 protocols

  • Series resistance compensation (>80%)

  • Junction potential correction

  • Temperature control (ideally at physiological temperature)

When comparing homomeric Kv2.1 to heteromeric Kv2.1/Kcns3 channels, maintain consistent expression conditions and recording parameters to isolate the effects of Kcns3 incorporation.

How can researchers develop effective antibodies for detecting endogenous rat Kcns3?

Developing reliable antibodies against rat Kcns3 requires strategic approaches due to the high conservation across species and potential cross-reactivity with other Kv channel family members. Recommended methodological steps include:

Antigen Selection:

  • Analyze the rat Kcns3 sequence for unique regions, preferably in the N- or C-terminus

  • Avoid transmembrane domains, which are highly conserved

  • Utilize sequence alignment tools to identify regions with minimal homology to other Kv channels

  • Consider multiple epitopes to increase success probability

Antibody Production Strategies:

  • Synthetic peptide antigens (15-20 amino acids) conjugated to carrier proteins

  • Recombinant protein fragments expressed in E. coli

  • Genetic immunization with Kcns3 DNA constructs

  • Consider both polyclonal (higher sensitivity) and monoclonal (higher specificity) approaches

Validation Requirements:

  • Western blot analysis comparing wild-type tissue with knockout controls (if available)

  • Immunoprecipitation followed by mass spectrometry

  • Immunocytochemistry with overexpression systems alongside negative controls

  • Pre-absorption controls with immunizing peptide

  • Cross-validation with independent antibodies targeting different epitopes

  • RNA-level detection (in situ hybridization or qPCR) to confirm expression pattern

Common Pitfalls and Solutions:

PitfallSolution
Cross-reactivityExtensive pre-absorption against related proteins
Low sensitivitySignal amplification methods (TSA, polymeric detection)
High backgroundOptimized blocking conditions and extended washing
Inconsistent resultsStandardized protocols and positive controls
Batch variabilityLarge-scale production and aliquoting

What are the recommended molecular cloning strategies for generating functional rat Kcns3 constructs?

For successful molecular cloning and expression of functional rat Kcns3 constructs, researchers should consider the following strategies:

Source Material:

  • RT-PCR from rat brain RNA (preferably frontal cortex or hippocampus)

  • Commercial cDNA clones with sequence verification

  • Synthetic gene synthesis for codon-optimized constructs

Vector Selection:

Vector TypeAdvantagesApplications
pCDNA3.1Strong CMV promoter, mammalian selectionElectrophysiology, cellular localization
pEGFP-N/CFluorescent tagging for visualizationTrafficking, localization studies
pGEMHEHigh expression in Xenopus oocytesElectrophysiology
pFastBacBaculovirus expressionProtein production for structural studies
Lentiviral vectorsStable integration, neuronal expressionIn vivo studies, primary cultures

Cloning Strategy:

  • Include 5' and 3' UTRs for proper expression regulation if studying native regulation

  • Consider directional cloning with unique restriction sites

  • Utilize Gibson Assembly or In-Fusion cloning for scarless construction

  • Incorporate epitope tags (His, FLAG, HA) for detection, but validate functional impact

  • Include Kozak consensus sequence for optimal translation initiation

Functional Modifications:

  • Site-directed mutagenesis for structure-function studies

  • Generation of dominant-negative constructs to study subunit interactions

  • Creation of chimeric constructs to identify key functional domains

  • Development of inducible or conditional expression systems

Quality Control:

  • Complete sequence verification with coverage of entire insert

  • Expression testing in heterologous systems with Western blot confirmation

  • Functional validation through co-expression with Kv2.1

  • Assessment of protein size and glycosylation pattern

  • Verification of subcellular localization with confocal microscopy

What experimental approaches are recommended for studying the physiological role of Kcns3 in neuronal circuits?

Investigating the physiological role of Kcns3 in neuronal circuits requires multidisciplinary approaches spanning molecular, cellular, and systems neuroscience. Recommended methodologies include:

Genetic Manipulation Approaches:

  • Conditional knockout models using Cre-loxP technology

  • RNAi-mediated knockdown with validated shRNA constructs

  • Viral-mediated overexpression or dominant-negative constructs

  • CRISPR/Cas9 gene editing for point mutations or reporter insertions

Electrophysiological Approaches:

  • Patch-clamp recordings in acute brain slices to measure:

    • Intrinsic excitability and firing patterns

    • Action potential waveform analysis

    • Delayed rectifier potassium currents

  • Field potential recordings to assess network activity

  • In vivo electrophysiology to correlate with behavior

Imaging Approaches:

  • Calcium imaging to monitor neuronal activity patterns

  • Voltage imaging with genetically-encoded voltage indicators

  • Two-photon imaging for in vivo circuit analysis

  • Super-resolution microscopy for subcellular localization

Behavioral Assessment:

  • Cognitive tasks relevant to cortical and hippocampal function

  • Sensorimotor gating tests (prepulse inhibition)

  • Social interaction paradigms

  • Learning and memory assessments

Data Analysis Framework:

LevelMethodsInsights
Single neuronAction potential waveform analysisDirect Kcns3 effects on excitability
MicrocircuitPaired recordings, connectivity mappingEffects on synaptic integration
NetworkLocal field potentials, oscillation analysisCircuit-level consequences
BehaviorCorrelation of neural activity with behaviorFunctional significance

When designing these experiments, it's crucial to include appropriate controls and consider compensatory mechanisms that may occur with chronic manipulations of Kcns3 expression.

How might Kcns3 dysfunction contribute to neuropsychiatric disorders?

Research has established connections between KCNS3 expression alterations and psychiatric disorders, particularly schizophrenia. Understanding these connections provides insights into potential mechanisms and therapeutic opportunities:

Evidence from Human Studies:

  • Reduced KCNS3 mRNA expression in prefrontal cortex of schizophrenia patients

  • Correlation between KCNS3 expression and cognitive dysfunction

  • Potential interactions with genetic risk factors for psychiatric disorders

Proposed Pathophysiological Mechanisms:

  • Altered excitation/inhibition balance in cortical circuits

  • Disrupted cortical oscillations, particularly gamma oscillations important for cognitive function

  • Abnormal dendritic integration of synaptic inputs

  • Modified sensitivity to oxidative stress pathways

Experimental Approaches to Study Disease Relevance:

  • Patient-derived induced neurons or brain organoids

  • Animal models with Kcns3 manipulations assessed for endophenotypes relevant to psychiatric disorders

  • Post-mortem tissue analysis correlating KCNS3 expression with neuropathological markers

  • Pharmacological interventions targeting channels containing Kcns3

Potential Therapeutic Implications:

  • Channel modulators that specifically target Kv2.1/Kcns3 heteromeric channels

  • Gene therapy approaches to normalize Kcns3 expression

  • Antioxidant strategies to mitigate oxidation-induced channel dysfunction

  • Circuit-specific interventions guided by understanding of Kcns3 expression patterns

What is the current understanding of Kcns3 regulation during development and aging?

The developmental regulation and age-related changes in Kcns3 expression and function represent important areas of investigation, with implications for both normal brain function and pathological conditions:

Developmental Expression Pattern:

  • Postnatal upregulation coinciding with critical periods of circuit refinement

  • Region-specific developmental trajectories

  • Activity-dependent regulation during circuit formation

  • Correlation with maturation of specific neuronal subtypes

Age-Related Changes:

  • Potential alterations in expression levels with advanced age

  • Increased susceptibility to oxidative modification

  • Compensatory changes in other channel subunits

  • Functional consequences for neuronal excitability and circuit function

Regulatory Mechanisms:

  • Transcriptional regulation by neuronal activity

  • Epigenetic modifications during development and aging

  • Post-translational modifications affecting channel assembly and trafficking

  • microRNA-mediated regulation of expression

Methodological Approaches for Developmental Studies:

  • Time-course analysis of expression in different brain regions

  • Electrophysiological characterization at different developmental stages

  • Cell-type specific profiling using single-cell RNA sequencing

  • Manipulation of expression at specific developmental timepoints

Understanding these developmental and age-related changes provides context for interpreting the role of Kcns3 in both normal brain function and in conditions where its expression or function is altered.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.