Recombinant Rat Potassium voltage-gated channel subfamily V member 1 (Kcnv1)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

Rat Kcnv1 belongs to the potassium voltage-gated channel subfamily V and is also known by several alternative designations including Kv8.1, HNKA, and Kv2.3r . This protein is primarily expressed in the brain, where it serves not as an independent channel-forming entity but as a modulatory subunit that regulates the function of other potassium channels . The rat Kcnv1 gene encodes a protein of 503 amino acids that shares substantial homology with its human counterpart, particularly in the membrane-spanning domains, while exhibiting distinctive variations in the intracellular N- and C-terminal regions .

Unlike conventional potassium channels that form functional tetrameric pores, Kcnv1 does not form functional channels independently. Instead, it serves as a regulatory subunit that modifies the biophysical properties and functional characteristics of other potassium channels, particularly those from the Kv2 family . This modulatory role makes Kcnv1 a critical component in the fine-tuning of neuronal excitability and signaling processes.

Functional Properties and Modulatory Role

Kcnv1 exhibits unique functional characteristics that distinguish it from conventional voltage-gated potassium channels. Unlike most members of the potassium channel family, Kcnv1 does not form functional homomeric channels when expressed alone in heterologous expression systems . This functional silence as an independent channel is a defining characteristic of Kcnv1.

Instead, Kcnv1 functions primarily as a modulatory subunit that regulates the biophysical properties of other potassium channels through heteromeric assembly. When co-expressed with members of the Kv2 family (particularly Kv2.1 and Kv2.2), Kcnv1 substantially alters their functional properties . Specifically, it:

  1. Shifts the threshold for inactivation to more negative potentials

  2. Slows the rate of inactivation

  3. Can down-regulate channel activity of KCNB1 (Kv2.1), KCNB2 (Kv2.2), KCNC4, and KCND1

This modulatory function appears to involve a trapping mechanism, whereby Kcnv1 may retain partner subunits in intracellular membranes, preventing their trafficking to the plasma membrane . The physiological significance of this regulatory mechanism likely relates to the fine-tuning of neuronal excitability and the modulation of action potential characteristics in specific neuronal populations.

Molecular Interactions and Regulatory Mechanisms

Research on related potassium channels suggests that the N- and C-terminal domains of Kcnv1 play crucial roles in determining its functional properties and interactions with other channel subunits. Studies of rat and human Kv2.1 channels have demonstrated that interactions between the N and C termini significantly influence channel activation kinetics .

Using glutathione S-transferase (GST) fusion proteins, researchers have confirmed direct binding between N-terminal regions (containing the T1 domain) and C-terminal regions of potassium channels . Given the structural similarities between Kv2.1 and Kcnv1, similar interactions likely occur in Kcnv1-containing heteromeric channels.

These molecular interactions may underlie the mechanism by which Kcnv1 modulates partner channels, potentially involving:

  1. Altered subunit assembly and trafficking

  2. Modified conformational changes during gating

  3. Recruitment of regulatory proteins or signaling molecules

  4. Changes in channel stability or turnover at the plasma membrane

Understanding these molecular mechanisms is essential for elucidating the physiological role of Kcnv1 in neuronal function and potentially identifying therapeutic targets for neurological disorders associated with potassium channel dysfunction.

Comparative Analysis with Human KCNV1

Comparing rat Kcnv1 with its human ortholog reveals important insights into the evolutionary conservation and species-specific adaptations of this channel subunit. Human KCNV1, located on chromosome 8q23.3, has been identified as a potential candidate gene for benign adult familial myoclonic epilepsy (BAFME), highlighting its clinical significance .

Studies comparing rat and human potassium channels have demonstrated that while the membrane-spanning regions are highly conserved between species, the intracellular N- and C-terminal domains exhibit greater variability . These terminal domains contain determinants that significantly influence channel kinetics and functional properties.

For example, in studies of Kv2.1 channels, specific residues in the N-terminal region (such as position Q67 in rat and D75 in human) and the C-terminal region (within the CTA domain, amino acids 740-853) have been shown to determine differences in activation kinetics between rat and human channels . Similar species-specific variations likely exist in Kcnv1 and may contribute to subtle differences in its modulatory effects across species.

Research Applications and Future Directions

Recombinant rat Kcnv1 protein serves as a valuable tool for various research applications, including:

  1. Structural studies to elucidate the three-dimensional architecture of the protein

  2. Development of specific antibodies for detection and localization studies

  3. Investigation of protein-protein interactions with partner channel subunits

  4. Functional characterization of heteromeric channels containing Kcnv1

  5. Identification of pharmacological agents that modulate Kcnv1-containing channels

Future research directions may focus on:

  1. Detailed mapping of Kcnv1 expression patterns in different brain regions and developmental stages

  2. Elucidation of the molecular mechanisms underlying Kcnv1's modulatory effects

  3. Investigation of potential roles in neurological disorders

  4. Development of targeted therapeutics that modulate Kcnv1-containing channels

  5. Comparative studies across species to identify evolutionarily conserved functions

Recent advances in structural biology techniques, such as cryo-electron microscopy, may soon provide high-resolution structures of Kcnv1-containing heteromeric channels, offering unprecedented insights into their molecular architecture and functional mechanisms.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Kcnv1; Potassium voltage-gated channel subfamily V member 1; Voltage-gated potassium channel subunit Kv2.3r; Voltage-gated potassium channel subunit Kv8.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-503
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcnv1
Target Protein Sequence
MDLSPRNRPLLDSSSLDSGSLTSLDSSVFCSEGEGEPLALGDCLTVNVGGSRFVLSQQAL SCFPHTRLGKLAVVVASYRRLGALAAAPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYY RTGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTDDQESQ HESEQDFSQGPCPTVRQKLWDILEKPGSSTAARIFGVISIIFVAVSIVNMALMSAELSWL NLQLLEILEYVCISWFTGEFILRFLCVKDRCHFLRKVPNIIDLLAILPFYITLLVESLSG SHTTQELENVGRLVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGI SIFSTIEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGI LVLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDIYARSIM EMLRLKGRERASTRSSGGDDFWF
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. Modulates the activity of KCNB1 and KCNB2 channels by shifting the inactivation threshold to more negative values and slowing the inactivation rate. It can down-regulate the channel activity of KCNB1, KCNB2, KCNC4, and KCND1, potentially by trapping them in intracellular membranes.
Database Links
Protein Families
Potassium channel family, V (TC 1.A.1.2) subfamily, Kv8.1/KCNV1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain, in neocortex, olfactory tubercle, hippocampus, dentate gyrus, piriform cortex and amygdala. Detected in Purkinje cells and granular cells of the cerebellum, in hippocampal CA4 neurons and neocortex pyramidal cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.