Recombinant Rat PQ-loop repeat-containing protein 1 (Pqlc1)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

Recombinant Pqlc1 is produced in heterologous systems for structural and functional studies. Below are key production parameters and applications:

Production Methods

ParameterDetailSource
Expression HostE. coli (His-tagged) or HEK293 cells (His/Fc-Avi tags)
TaggingN-terminal His-tag for purification; Fc-Avi tags for antibody binding
Purity≥85–90% (SDS-PAGE)

Functional Insights and Research Findings

While PQLC1’s precise role is not fully characterized, studies on homologs provide indirect clues:

  • PQLC2, a related protein, functions as a lysosomal cationic amino acid (CAA) transporter in mammals .

  • Yeast homologs (Ypq1-3) regulate vacuolar CAA homeostasis, suggesting conserved transport roles .

Hypothesized Mechanisms

MechanismEvidenceSource
Electrogenic TransportPQLC2 mediates pH-dependent CAA efflux ; PQLC1 may share similar activity
Cystine HandlingIndirect association via SLC66 family links to lysosomal cystine transport

Challenges and Research Gaps

ChallengeCurrent StatusPotential Solutions
Functional ElucidationLimited direct studies on PQLC1; reliance on homolog data (e.g., PQLC2)Heterologous expression assays, CRISPR knockout models
Subcellular LocalizationPredicted membrane localization; empirical validation neededConfocal microscopy, organelle fractionation
Pathological RelevanceNo direct links to disease; inferred from SLC66 associationsOmics studies, disease model screens

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if you have a special requirement. We will fulfill your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Slc66a2; Pqlc1; Solute carrier family 66 member 2; PQ-loop repeat-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Pqlc1
Target Protein Sequence
MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVA NILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNVKRRSFAATDSKDEE LRVPPRRPYLDFDPHHFWHWSSFADYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVL TEAMLGVPQLYRNYRHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVCGLLQVMV DLAILGQAYAFAHHPQKPAPHAVHPASAKAL
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How conserved is Pqlc1 across different species?

Pqlc1 shows significant sequence conservation across mammalian species, suggesting important evolutionary conserved functions. Based on the available data:

SpeciesSequence Identity to Human Pqlc1UniProt ID
Human100% (reference)Q8N2U9
RatNot specified directlyQ5M880
Mouse88% (to human antigen sequence)Not specified

The conservation of the antigen sequence used for antibody production shows 88% identity between human and mouse, and 90% identity between human and rat . This high degree of conservation indicates functional importance across mammalian species.

When designing cross-species experiments, researchers should consider these sequence similarities, particularly when using antibodies or other detection methods that rely on sequence-specific recognition.

What experimental approaches are most effective for studying Pqlc1 expression patterns?

To effectively study Pqlc1 expression patterns, consider these methodological approaches:

  • RT-qPCR: For quantitative analysis of Pqlc1 mRNA expression across different tissues or under various experimental conditions. Design primers specific to rat Pqlc1 (UniProt ID: Q5M880) .

  • Western Blotting: Using specific antibodies against rat Pqlc1. Commercially available antibodies like polyclonal antibodies can detect the protein in rat tissue lysates .

  • Immunohistochemistry/Immunofluorescence: For visualizing tissue and subcellular localization. When designing these experiments, consider:

    • Using appropriate fixation methods for membrane proteins

    • Including controls to validate antibody specificity

    • Co-staining with organelle markers to determine subcellular localization

  • In situ hybridization: For detecting Pqlc1 mRNA in tissue sections, providing spatial information about gene expression.

When analyzing expression data, compare results across multiple techniques to ensure consistency and reliability of findings. This multi-method approach is particularly important for novel or less-characterized proteins like Pqlc1.

What are the optimal storage conditions for recombinant rat Pqlc1?

Based on commercial recombinant rat Pqlc1 specifications, the recommended storage conditions are:

  • Long-term storage: -20°C to -80°C

  • Working aliquots: 4°C for up to one week

  • Storage buffer: Typically Tris-based buffer with 50% glycerol, optimized for protein stability

Important methodological considerations:

  • Avoid repeated freeze-thaw cycles: These can significantly reduce protein activity and integrity. Create single-use aliquots upon first thawing .

  • Reconstitution protocol: When using lyophilized preparations, reconstitute in the recommended buffer under sterile conditions.

  • Quality control testing: Before using in critical experiments, verify protein integrity by:

    • SDS-PAGE to confirm molecular weight

    • ELISA or functional assays to confirm activity

    • Spectrophotometric analysis to determine concentration

Following these storage protocols will maximize the stability and functional activity of recombinant rat Pqlc1 in experimental settings.

What experimental approaches are recommended for studying Pqlc1 protein-protein interactions?

To investigate protein-protein interactions involving rat Pqlc1, consider these methodological approaches:

  • Co-Immunoprecipitation (Co-IP):

    • Useful for identifying native protein complexes

    • Design: Use specific anti-Pqlc1 antibodies to pull down the protein complex from rat tissue or cell lysates

    • Controls: Include IgG controls and reverse Co-IP to validate interactions

  • Proximity Ligation Assay (PLA):

    • For visualizing protein-protein interactions in situ

    • Provides spatial information about where interactions occur within cells

    • Particularly valuable for membrane proteins like Pqlc1

  • Yeast Two-Hybrid Screening:

    • For identifying novel interaction partners

    • Considerations: Membrane proteins like Pqlc1 may require modified approaches such as split-ubiquitin yeast two-hybrid systems

  • Pull-down Assays with Recombinant Proteins:

    • Using purified recombinant rat Pqlc1 as bait

    • Can confirm direct interactions identified in other screening methods

Based on studies of related proteins, the WDR41-PQLC2 interaction is mediated by a short peptide motif in a flexible loop, suggesting similar interaction mechanisms might exist for Pqlc1 . When designing peptide interaction studies for Pqlc1, consider:

  • Focusing on flexible loop regions that might extend from the protein

  • Using fusion constructs (like EGFP fusions) to test specific Pqlc1 peptide sequences for binding activity

  • Including appropriate controls to validate specific versus non-specific interactions

How can I validate the functionality of recombinant rat Pqlc1 in experimental assays?

Validating the functionality of recombinant rat Pqlc1 presents unique challenges due to limited established functional assays. Consider these methodological approaches:

  • Binding Assays:

    • Similar to methods used for other recombinant proteins such as Agrin , develop binding assays using functional ELISA

    • Identify potential binding partners based on homology with related proteins like PQLC2

  • Reconstitution in Artificial Membranes:

    • For putative transporter activity testing

    • Proteoliposome-based transport assays with fluorescent substrate analogs

    • Measure substrate flux or membrane potential changes

  • Cell-Based Functional Assays:

    • Transfect Pqlc1-deficient cells with recombinant rat Pqlc1

    • Assess restoration of cellular phenotypes or transport functions

    • Use appropriate controls including inactive mutants

  • Structural Integrity Validation:

    • Circular dichroism to confirm secondary structure integrity

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to evaluate stability

When comparing different batches or preparations, establish standardized validation protocols to ensure experimental reproducibility, similar to quality control practices used for other recombinant proteins .

How can I design experiments to study the membrane topology of Pqlc1?

Understanding the membrane topology of Pqlc1 is crucial for elucidating its function. Consider these methodological approaches:

  • Computational Prediction and Modeling:

    • Use multiple topology prediction algorithms (TMHMM, Phobius, TopPred)

    • Compare predictions with experimental data

    • Generate 3D structural models based on homology with related proteins

  • Experimental Topology Mapping:

    • Substituted Cysteine Accessibility Method (SCAM):

      • Introduce cysteine residues at specific positions

      • Test accessibility to membrane-impermeable sulfhydryl reagents

      • Map transmembrane segments and orientation

    • Protease Protection Assays:

      • Express epitope-tagged Pqlc1 variants

      • Determine protease accessibility in intact vs. permeabilized membranes

      • Map cytoplasmic and luminal/extracellular domains

  • Fluorescence-Based Approaches:

    • FRET Analysis:

      • Tag different domains with fluorescent proteins

      • Measure energy transfer to determine spatial relationships

      • Map protein folding and domain organization

When designing these experiments, consider that based on homology with other PQ-loop proteins, Pqlc1 likely contains multiple transmembrane domains. The experimental approach should be adaptable to confirm or refute bioinformatic predictions.

What methods are appropriate for investigating Pqlc1's potential role as a transporter?

As a member of the solute carrier family (SLC66A2) , Pqlc1 likely functions as a transporter. To investigate this function:

  • Substrate Identification:

    • Transport Assays in Heterologous Expression Systems:

      • Express rat Pqlc1 in Xenopus oocytes or mammalian cell lines

      • Screen potential substrates using radiolabeled compounds or fluorescent analogs

      • Measure uptake/efflux kinetics and compare to controls

    • Metabolomic Approaches:

      • Compare metabolite profiles between Pqlc1-overexpressing and control cells

      • Identify accumulating or depleted metabolites as potential substrates

  • Transport Kinetics Characterization:

    • Determine Km and Vmax values for identified substrates

    • Test pH and ion dependence of transport activity

    • Examine effects of potential inhibitors

  • Electrophysiological Methods:

    • If transport is electrogenic, use patch-clamp techniques

    • Measure transport-associated currents in Pqlc1-expressing cells

    • Characterize current-voltage relationships and ion selectivity

  • Reconstitution in Artificial Membranes:

    • Incorporate purified recombinant rat Pqlc1 into proteoliposomes

    • Measure substrate flux using fluorescent probes or radiolabeled compounds

    • Define minimal requirements for transport activity

When designing these experiments, consider using experimental approaches similar to those used for studying other recombinant rat transporters and membrane proteins .

How can I establish and validate Pqlc1 knockout/knockdown models?

Generating Pqlc1 knockout/knockdown models is essential for investigating its physiological functions. Consider these methodological approaches:

  • CRISPR/Cas9-Based Knockout Generation:

    • Target Design:

      • Design gRNAs targeting conserved regions of rat Pqlc1

      • Target early exons to ensure complete functional disruption

      • Use multiple gRNAs to increase efficiency

    • Validation Methods:

      • Genomic PCR and sequencing to confirm mutations

      • RT-qPCR to verify mRNA reduction/absence

      • Western blotting to confirm protein elimination

      • Functional assays to demonstrate loss of Pqlc1-dependent processes

  • RNAi-Based Knockdown Approaches:

    • siRNA Design:

      • Design multiple siRNAs targeting different regions of Pqlc1 mRNA

      • Include scrambled siRNA controls

      • Optimize transfection conditions for target cells

    • Validation Protocol:

      • Quantify knockdown efficiency by RT-qPCR and Western blotting

      • Assess dose-dependent and time-course effects

      • Control for off-target effects using rescue experiments

  • Phenotypic Analysis Framework:

    • Compare with wild-type controls under identical conditions

    • Examine both cellular and physiological parameters

    • Design rescue experiments to confirm specificity

When reporting results from knockout/knockdown models, include detailed characterization of the model to ensure reproducibility, following experimental design principles outlined in methodological guidelines .

How can I differentiate between the functions of Pqlc1 and its homologues (PQLC2, PQLC3) in experimental settings?

Differentiating between Pqlc1 and its homologues requires careful experimental design:

  • Selective Manipulation Strategies:

    • Specific Targeting:

      • Design highly specific siRNAs or CRISPR guides that do not cross-react

      • Validate specificity by measuring effects on each homologue

      • Use selective knockdown/knockout of individual family members

    • Selective Inhibition:

      • Develop specific inhibitors or blocking antibodies

      • Design peptide inhibitors based on unique sequences in each protein

      • Validate specificity across all family members

  • Comparative Expression Analysis:

    • Co-Expression Studies:

      • Determine tissue-specific expression patterns of all three proteins

      • Identify tissues with differential expression for functional studies

      • Use this information to select appropriate cell models

    • Subcellular Localization:

      • Compare intracellular distribution of the three proteins

      • Identify unique localization patterns that suggest distinct functions

  • Domain Swap Experiments:

    • Create chimeric proteins by swapping domains between Pqlc1, PQLC2, and PQLC3

    • Test which domains confer specific functional properties

    • Map functional differences to specific protein regions

Based on research with PQLC2, which interacts with WDR41 through a specific motif , examine whether Pqlc1 shares similar interaction partners or has unique binding properties. This could provide insights into functional divergence within the family.

What experimental designs can help elucidate Pqlc1's role in cellular signaling pathways?

To investigate Pqlc1's potential role in cellular signaling:

  • Interactome Analysis:

    • Proximity Labeling Approaches:

      • Fuse Pqlc1 with BioID or APEX2 enzymes

      • Identify proteins in close proximity under different conditions

      • Map potential signaling partners

    • Co-Immunoprecipitation with Phospho-Profiling:

      • Pull down Pqlc1 complexes before and after stimulation

      • Analyze phosphorylation status of interacting proteins

      • Identify dynamic changes in the interactome

  • Signaling Pathway Analysis:

    • Phospho-Kinase Arrays:

      • Compare phosphorylation profiles between wild-type and Pqlc1-deficient cells

      • Identify affected signaling nodes

      • Validate with phospho-specific antibodies

    • Reporter Assays:

      • Use pathway-specific transcriptional reporters

      • Measure effects of Pqlc1 manipulation on signaling output

      • Test responses to different stimuli

  • Systems Biology Approach:

    • Multi-omics Integration:

      • Combine transcriptomics, proteomics, and metabolomics data

      • Map Pqlc1-dependent networks

      • Use computational modeling to predict pathway connections

When designing these experiments, consider approaches similar to those used in studies of signaling pathways involving other membrane proteins or transporters . Integrate multiple methodological approaches to build a comprehensive understanding of Pqlc1's signaling role.

How can I address solubility issues when working with recombinant rat Pqlc1?

As a membrane protein, Pqlc1 presents inherent solubility challenges. Consider these methodological solutions:

  • Optimized Buffer Conditions:

    • Test various detergents (DDM, CHAPS, digitonin) at different concentrations

    • Evaluate different buffer compositions (pH, salt concentration, additives)

    • Include stabilizing agents like glycerol (typically 50% as used in commercial preparations)

  • Fusion Tag Selection:

    • Compare solubility enhancement with different tags (His, MBP, SUMO, GST)

    • Test tag position effects (N-terminal vs. C-terminal)

    • Consider dual tagging strategies for difficult constructs

  • Expression Optimization:

    • Adjust expression temperature and induction conditions

    • Test different expression systems (bacterial, insect, mammalian)

    • Consider co-expression with chaperones

  • Validation Protocol:

    • Assess protein quality by size-exclusion chromatography

    • Confirm proper folding by circular dichroism

    • Verify functionality with appropriate assays

When reporting methods, include detailed conditions that successfully addressed solubility issues to help other researchers working with this challenging protein.

What are the best approaches to resolve contradictory experimental results when studying Pqlc1?

When facing contradictory results in Pqlc1 research:

  • Systematic Validation Framework:

    • Independent Verification:

      • Repeat experiments using different techniques

      • Collaborate with other labs to confirm findings

      • Use multiple antibodies or detection methods

    • Controls Assessment:

      • Review all positive and negative controls

      • Include additional specificity controls

      • Test for potential interfering factors

  • Parameter Variation Analysis:

    • Create a matrix of experimental conditions

    • Systematically vary one parameter at a time

    • Identify variables that affect reproducibility

  • Data Integration Approach:

    • Combine results from multiple methodologies

    • Weight evidence based on methodological strength

    • Look for convergent findings across different approaches

Consider that cellular context might significantly impact Pqlc1 function, similar to observations with other membrane proteins. Document all experimental conditions thoroughly to identify potential sources of variability.

What innovative approaches might advance our understanding of Pqlc1's physiological roles?

Cutting-edge methodologies that could advance Pqlc1 research include:

  • Advanced Imaging Technologies:

    • Super-Resolution Microscopy:

      • Track Pqlc1 dynamics in living cells

      • Resolve subcellular localization at nanometer scale

      • Identify transient interactions with other proteins

    • Correlative Light and Electron Microscopy (CLEM):

      • Precisely localize Pqlc1 within cellular ultrastructure

      • Map relationship to membranous organelles

      • Understand spatial context of protein function

  • In Vivo Functional Analysis:

    • Conditional Tissue-Specific Knockout Models:

      • Generate rat models with temporal control of Pqlc1 deletion

      • Examine tissue-specific phenotypes

      • Investigate developmental versus adult functions

    • Intravital Imaging:

      • Visualize Pqlc1 dynamics in living tissues

      • Track physiological responses in real-time

      • Correlate with functional outcomes

  • Human Disease Relevance:

    • Patient-Derived Models:

      • Generate iPSCs from patients with potential Pqlc1-related disorders

      • Differentiate into relevant cell types

      • Compare with gene-edited isogenic controls

    • Multi-omics Integration:

      • Similar to approaches used in other studies , combine genomics, proteomics, and metabolomics

      • Identify disease-relevant pathways

      • Connect Pqlc1 function to human pathophysiology

These innovative approaches could help place Pqlc1 research in broader physiological and pathological contexts, advancing beyond basic characterization to functional understanding.

How might comparative studies between Pqlc1 and other PQ-loop proteins inform experimental design?

Leveraging knowledge from better-studied PQ-loop proteins can inform Pqlc1 research:

  • Structural Comparison Approach:

    • Align sequences of multiple PQ-loop proteins

    • Identify conserved versus divergent domains

    • Design experiments targeting unique Pqlc1 features

  • Functional Crosstalk Analysis:

    • Simultaneous Manipulation:

      • Generate double or triple knockouts of PQ-loop family members

      • Investigate compensatory mechanisms

      • Identify redundant versus unique functions

    • Domain Swap Experiments:

      • Create chimeric proteins between Pqlc1 and other family members

      • Map functional domains

      • Identify critical regions for specific activities

  • Evolutionary Insights:

    • Study Pqlc1 orthologs across species, including non-mammalian models

    • Examine functional conservation and divergence

    • Identify core versus species-specific functions

Based on findings with PQLC2, which interacts with WDR41 through a specific motif in a flexible loop , similar interaction mechanisms might exist for Pqlc1. This information could guide the design of protein-protein interaction studies for Pqlc1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.