Recombinant Rat PRA1 family protein 3 (Arl6ip5)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat PRA1 Family Protein 3 (ARL6IP5)

Recombinant Rat PRA1 Family Protein 3 (ARL6IP5), also known as ADP-ribosylation factor-like 6 interacting protein 5, is a recombinant protein produced in E. coli through bacterial expression systems. This protein is a member of the PRA1 family and is critical in modulating cellular processes such as glutamate transport, cytoskeletal dynamics, and neuroprotection. Its rat ortholog (UniProt ID: Q9ES40) shares structural and functional homology with human ARL6IP5 (O75915) and has been extensively studied for its role in neuronal regulation and oxidative stress responses .

Regulation of Glutamate Transport

ARL6IP5 binds to and inhibits the glutamate transporter EAAC1 (SLC1A1), reducing intracellular glutamate uptake in a PKC-dependent manner . This modulation is critical for maintaining glutamate homeostasis, particularly in neuronal cells where excess glutamate can trigger excitotoxicity . Retinoic acid upregulates ARL6IP5 expression, amplifying its inhibitory effects on EAAC1-mediated transport .

Neuroprotection and Oxidative Stress

In rodent models, ARL6IP5 knockdown or overexpression alters glutathione levels and neuronal resilience. Rat studies show that ARL6IP5 disruption increases neuronal glutathione content, enhancing protection against oxidative stress . This aligns with its role in mitochondrial membrane stability and autophagy regulation, as observed in Arl6ip1 knockout models (a related PRA1 family member) .

Cytoskeletal and Membrane Interactions

ARL6IP5 associates with the cytoskeleton and regulates membrane trafficking. Its interaction with Rab GTPases (e.g., Rab29) and prenylated proteins suggests a role in vesicle transport and organelle dynamics .

Research Applications and Production Protocols

Table 2: Applications and Production Data

ApplicationDetailsSource
Expression SystemE. coli with N-terminal His-tag for affinity purification
PurificationNickel-affinity chromatography followed by SDS-PAGE validation
Storage-20°C/-80°C in lyophilized powder with 50% glycerol (long-term)
Reconstitution0.1–1.0 mg/mL in sterile water; avoid repeated freeze-thaw cycles
Key Uses- Glutamate transport assays
- Neuroprotection studies
- Cytokeletal interaction mapping

Recombinant ARL6IP5 is used in:

  • In vitro transport assays to study EAAC1 modulation.

  • Neurological disease models to explore oxidative stress resistance.

  • Protein interaction studies (e.g., co-IP with SLC1A1 or Rab GTPases) .

Comparative Analysis with Other Orthologs

Table 3: Cross-Species ARL6IP5 Homology

SpeciesUniProt IDSequence Identity (%)Key Functional RoleSource
RatQ9ES4085% (Mouse), 100% (Rat)Glutamate transport inhibition, neuroprotection
HumanO7591585% (Rat)Vitamin A-responsive cytoskeletal regulation
MouseQ9D6Z885% (Rat)Enhanced learning/memory in knockout models

Rat ARL6IP5 shares high conservation with human and mouse orthologs, enabling cross-species functional studies. Its role in EAAC1 regulation is conserved, while species-specific differences in neuroprotection pathways warrant further investigation .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate your needs in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
Arl6ip5; Gtrap3-18; Jwa; Pra2; Praf3; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5; GTRAP3-18; Glutamate transporter EAAC1-interacting protein; Prenylated Rab acceptor protein 2; Protein JWa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Arl6ip5
Target Protein Sequence
MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGIIVVLVFTGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDSINKFA DYISKARE
Uniprot No.

Target Background

Function
This protein regulates intracellular concentrations of taurine and glutamate (Ref.5). It negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate in a PKC activity-dependent manner. It also plays a role in retaining SLC1A1/EAAC1 in the endoplasmic reticulum.
Gene References Into Functions
  1. These observations suggest that JWA is directly involved in the regulation of chronic morphine dependence. PMID: 21600884
  2. The expression and distribution of the neuronal glutamate transporter, excitatory amino acid carrier-1 (EAAC1), are demonstrated in the dorsal root ganglion neurons and their central terminals. PMID: 14751295
  3. Results suggest a model where protein trafficking and neuronal differentiation are directly linked by the interaction of Rab1 and its regulator GTRAP3-18. PMID: 18363836
Database Links
Protein Families
PRA1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, cytoskeleton.
Tissue Specificity
Ubiquitous. Most abundant in heart and brain. In the embryonic brain cortex, expressed in neurons and astrocytes.

Q&A

What is Arl6ip5 and what are its alternate names across species?

Arl6ip5 belongs to the PRAF3 family and contains a functionally large prenylated acceptor domain 1 primarily involved in intracellular protein trafficking. It is known by several names across species: JWA in humans, Addicsin in mice, and GTRAP 3-18 or JM4 in rats . This protein is also referred to as PRA1 family protein 3, prenylated Rab acceptor protein 2, and glutamate transporter EAAC1-interacting protein . These various nomenclatures reflect the protein's discovery in different research contexts and its multifunctional nature.

What are the primary cellular functions of Arl6ip5?

Arl6ip5 serves multiple critical cellular functions:

  • Negative regulation of the EAAC1 glutamate transporter, affecting glutamatergic neurotransmission

  • Involvement in intracellular protein trafficking via its prenylated acceptor domain

  • Association with cytoskeletal components, potentially regulating cellular architecture

  • Induction of autophagy through interaction with ATG12, promoting clearance of protein aggregates

  • Participation in Golgi organization and vesicular trafficking pathways

  • Regulation of cell differentiation processes

Research has established that Arl6ip5 plays a significant role in the ARL6IP5/Rab1/ATG12 axis for neuroprotection, particularly in neurodegenerative conditions like Parkinson's disease .

How is Arl6ip5 expression regulated in neural tissues?

Arl6ip5 expression is regulated by multiple factors:

  • Vitamin A and retinoic acid significantly upregulate Arl6ip5 expression, which consequently reduces EAAC1-mediated glutamate transport

  • Age-related decline has been documented, with studies showing significant decreases (44 ± 17%, p = 0.0015) in ARL6IP5 levels at 12 months compared to 4 months

  • In Parkinson's disease models, α-synuclein overexpression leads to substantial downregulation (59 ± 25%, p < 0.0001) of ARL6IP5 levels

  • Transgenic mouse models of PD show lower levels of ARL6IP5 compared to wild-type controls across all time points examined

This dynamic regulation suggests that Arl6ip5 expression is carefully controlled based on developmental stage, age, and pathological conditions, indicating its critical role in neuronal homeostasis.

What major signaling pathways involve Arl6ip5?

Arl6ip5 participates in several important signaling pathways:

Pathway NameAssociated Proteins
Glutamate Neurotransmitter Release CycleUNC13B, RAB3AB, SYT1A, BZRAP1, PPFIA4, SNAP25B, SLC1A2A, SLC1A3B
Neuronal SystemKCNC1B, KCND2, KCNJ14, KCNS2, BCHE, KCNA2, PPFIA4, KCNC1, PANX1
Neurotransmitter Release CycleSLC1A2A, SLC1A2B, ARL6IP5A, Apba1, LIN7C, SYN3, SLC1A7B
Transmission across Chemical SynapsesSLC18A3A, Apba1, HAND2, SLC1A3A, SNAP25B, CAMKK1B, PPFIA2

Its involvement in these pathways indicates a significant role in neuronal function and neurotransmitter regulation .

What methodologies are most effective for studying Arl6ip5's role in autophagy induction?

Research on Arl6ip5's role in autophagy can be conducted using multiple complementary approaches:

  • Overexpression studies: Transfection with flag-ARL6IP5 construct (5 μg for 36 h) has been shown to induce autophagy comparable to standard inducers like serum starvation, rapamycin (1 μM for 2 h), and MeβCD (100 μM for 24 h) .

  • Knockout/knockdown approaches: siRNA-mediated knockdown of ARL6IP5 followed by assessment of autophagy markers (LC3-II/LC3-I ratio) demonstrates its necessity in autophagy. ARL6IP5 knockout cell lines (like those available in HeLa cells) allow for comprehensive investigation of its functional absence .

  • LC3 puncta quantification: Immunofluorescence assays measuring LC3 puncta formation have shown that ARL6IP5 overexpression produced approximately 35 ± 5 puncta (p < 0.0001), compared to control cells with 8 ± 2.2 puncta .

  • Autophagy flux assessment: Using chloroquine or bafilomycin A1 to block autophagosome-lysosome fusion while manipulating ARL6IP5 levels helps distinguish between autophagy induction versus impaired clearance .

  • Co-immunoprecipitation: This technique is essential for identifying interactions with ATG12 and other autophagy machinery components .

These methodologies should be combined with appropriate controls, including empty vector transfection controls to rule out effects from transfection reagents alone .

How does Arl6ip5 interact with α-synuclein, and what are the implications for Parkinson's disease research?

Arl6ip5 demonstrates significant interactions with α-synuclein that have important implications for Parkinson's disease research:

  • Expression relationship: α-Synuclein overexpression downregulates ARL6IP5 (by 59 ± 25%, p < 0.0001), while A53T mutant α-synuclein causes even more pronounced reduction (60 ± 25%, p < 0.0001) . This suggests a pathological mechanism where α-synuclein may inhibit protective autophagy by suppressing ARL6IP5.

  • Rescue effect: ARL6IP5 overexpression in cells expressing A53T mutant α-synuclein reduces green fluorescence (a measure of α-synuclein expression) from 58 ± 24 in control cells to 28 ± 33 in ARL6IP5 transfected cells (p < 0.0001) .

  • Toxicity modulation: siRNA-mediated knockdown of ARL6IP5 in α-synuclein overexpressing cells increases toxicity by 15 ± 7% (p = 0.018) compared to α-synuclein overexpression alone .

  • Autophagy enhancement: ARL6IP5 overexpression increases autophagy (150 ± 54%, p = 0.108), which promotes clearance of toxic protein aggregates like α-synuclein in Parkinson's disease models .

These findings suggest that strategies targeting ARL6IP5 enhancement could potentially mitigate α-synuclein-related pathology in Parkinson's disease by counteracting α-synuclein's inhibitory effect on autophagy.

What experimental approaches can be used to investigate the role of Arl6ip5 in vesicular trafficking?

Investigating Arl6ip5's role in vesicular trafficking requires specialized techniques:

  • Live cell imaging: Using fluorescently tagged Arl6ip5 and markers for various vesicular compartments (Rab proteins, SNARE proteins) to track co-localization and dynamics in real-time .

  • Proximity ligation assays: To detect transient interactions between Arl6ip5 and vesicular trafficking machinery components in situ .

  • Subcellular fractionation: To determine the distribution of Arl6ip5 among different cellular compartments including Golgi, ER, and transport vesicles .

  • CRISPR-Cas9 genome editing: Creating specific functional domain mutations to identify regions responsible for trafficking functions .

  • Transmission electron microscopy: To visualize ultrastructural changes in vesicular compartments after Arl6ip5 manipulation .

  • Cargo tracking assays: Monitoring the transport of selected cargoes (e.g., EAAC1 transporter) in the presence of wild-type versus mutant or depleted Arl6ip5 .

These approaches collectively provide a comprehensive analysis of how Arl6ip5 contributes to the complex processes of vesicular trafficking and membrane dynamics.

How can researchers distinguish between the direct and indirect effects of Arl6ip5 on autophagy?

Distinguishing between direct and indirect effects of Arl6ip5 on autophagy requires sophisticated experimental approaches:

  • Structure-function analysis: Creating deletion mutants of Arl6ip5 to identify specific domains required for interaction with ATG12 and other autophagy machinery components .

  • Temporal analysis: Using inducible expression systems to track the sequence of events following Arl6ip5 induction, determining which autophagy markers change first .

  • Proteomic analysis: Performing mass spectrometry on immunoprecipitated Arl6ip5 complexes at different time points after induction to identify direct binding partners .

  • In vitro reconstitution: Using purified components to test if Arl6ip5 directly affects processes like ATG12-ATG5 conjugation or phagophore elongation .

  • Phosphorylation analysis: Investigating whether Arl6ip5 affects the phosphorylation status of autophagy regulators like ULK1, Beclin-1, or mTOR .

What are the critical considerations for designing experiments with Arl6ip5 knockout models?

Designing experiments with Arl6ip5 knockout models requires careful consideration of several factors:

  • Compensation mechanisms: Chronic Arl6ip5 deletion may trigger compensatory upregulation of functionally related proteins, potentially masking phenotypes. Using inducible knockout systems or acute knockdown approaches in parallel can help address this issue .

  • Cell type specificity: Arl6ip5 functions may vary between cell types. Research should compare phenotypes across multiple relevant cell types (neurons, glia, HeLa cells, etc.) to establish cell-specific versus universal functions .

  • Temporal dynamics: Age-dependent changes in Arl6ip5 expression suggest that knockout effects may vary with developmental stage or age. Experimental designs should account for this by examining phenotypes across multiple time points .

  • Rescue controls: Including rescue experiments with wild-type and mutant forms of Arl6ip5 is essential to confirm specificity and identify critical functional domains .

  • Stress conditions: Some Arl6ip5 functions may only become apparent under specific stress conditions. Experiments should include both basal and stressed conditions (e.g., nutrient deprivation, oxidative stress, proteotoxic stress) .

What methodological approaches are most effective for purifying and maintaining the stability of recombinant Arl6ip5?

Purifying and maintaining stable recombinant Arl6ip5 requires specialized techniques due to its membrane-associated nature:

  • Expression systems: Comparison of bacterial (E. coli), insect cell, and mammalian expression systems shows that mammalian systems (particularly HEK293) tend to produce more properly folded and functionally active Arl6ip5 .

  • Fusion tags: His, GST, SUMO, and Fc tags have been used with Arl6ip5, with SUMO tags often providing enhanced solubility and stability while maintaining native-like conformation .

  • Solubilization strategies: Due to its membrane association, gentle detergents at optimized concentrations effectively solubilize Arl6ip5 while preserving its structural integrity .

  • Storage conditions: Optimized conditions include flash-freezing aliquots in liquid nitrogen and storing at -80°C with protease inhibitors and reducing agents to prevent degradation and oxidation .

  • Quality control: Size-exclusion chromatography coupled with multi-angle light scattering and circular dichroism spectroscopy help verify proper folding and homogeneity of the purified protein .

  • Functional validation: Activity assays measuring interaction with known binding partners (e.g., ATG12, EAAC1) confirm that the purified protein retains its biological functions .

These approaches collectively enhance the yield and quality of recombinant Arl6ip5 for structural and functional studies.

What confounding factors should researchers consider when interpreting Arl6ip5 experimental results?

When interpreting Arl6ip5 experimental results, researchers should consider several potential confounding factors:

  • Expression level artifacts: Extreme overexpression of Arl6ip5 may disrupt membrane organization or create non-physiological interactions, leading to artifactual results. Titrating expression levels and using endogenous tagging approaches can mitigate this issue .

  • Tag interference: Common tags (GFP, FLAG, His) may affect Arl6ip5 localization or function, particularly given its membrane association. Comparing different tagging strategies and complementing with untagged protein studies is advisable .

  • Temporal dynamics: Arl6ip5's effects on autophagy and other processes may vary with time. Single time-point measurements may miss important dynamic changes, necessitating time-course experiments .

  • Cell line variations: Different cell lines show varying baseline levels of autophagy, glutamate transport, and vesicular trafficking, which can affect the magnitude of Arl6ip5-mediated effects. Using multiple cell lines helps establish robust findings .

  • Stress induced by manipulation: Experimental manipulations themselves (transfection, viral transduction) can induce stress responses that interact with Arl6ip5 functions. Appropriate controls and multiple methodological approaches are essential .

Careful consideration of these factors improves the reliability and interpretability of Arl6ip5 research findings.

How does Arl6ip5 contribute to neuroprotection in models of neurodegenerative disease?

Arl6ip5 contributes to neuroprotection in neurodegenerative disease models through several mechanisms:

  • Autophagy enhancement: Arl6ip5 overexpression increases autophagy (150 ± 54%, p = 0.108), which promotes clearance of toxic protein aggregates like α-synuclein in Parkinson's disease models .

  • Aggregate reduction: Direct measurements show ARL6IP5 reduces A53T-α-synuclein fluorescence from 58 ± 24 in control cells to 28 ± 33 in ARL6IP5 transfected cells (p < 0.0001) .

  • Cell survival improvement: In cellular models of Parkinson's disease, ARL6IP5 overexpression reduces toxicity, while its knockdown increases vulnerability to α-synuclein-induced damage by 15 ± 7% (p = 0.018) .

  • Restoration of pathway signaling: ARL6IP5 restores cellular pathways disrupted by α-synuclein, including phosphorylation of key signaling molecules like Mek and Mer .

  • Age-related compensation: Given that ARL6IP5 levels decline with age (44 ± 17%, p = 0.0015 reduction at 12 months compared to 4 months), its supplementation may be particularly beneficial in age-related neurodegenerative conditions .

These findings collectively support ARL6IP5 as a potential therapeutic target for neurodegenerative diseases, particularly those involving protein aggregation and impaired autophagy.

How can researchers effectively combine in vitro and in vivo approaches to study Arl6ip5 functions?

Effective combination of in vitro and in vivo approaches for studying Arl6ip5 requires strategic experimental design:

  • Sequential validation pipeline: Starting with high-throughput in vitro screens to identify key interactions or effects, followed by validation in cell culture systems, and ultimately testing in animal models provides a robust validation pathway .

  • Matched experimental conditions: Ensuring consistent experimental parameters (expression levels, cellular stressors) between in vitro and in vivo studies facilitates direct comparison of results .

  • Bidirectional translation: Using findings from animal models to inform mechanistic in vitro studies, and vice versa, creates a feedback loop that strengthens both approaches .

  • Complementary strengths: In vitro systems offer precise mechanistic control and molecular detail, while in vivo models capture physiological complexity and systemic effects. Designing experiments that leverage these complementary strengths provides comprehensive insights .

  • Tissue-specific investigations: Given Arl6ip5's varying functions across tissues, parallel studies in tissue-specific cell cultures and corresponding in vivo tissue-specific knockout models can reveal context-dependent functions .

This integrated approach maximizes the strengths of both experimental paradigms while minimizing their individual limitations.

How can researchers reconcile the diverse functions of Arl6ip5 across different cellular contexts?

The diverse functions of Arl6ip5 across cellular contexts can be reconciled through several research approaches:

  • Domain-specific analysis: Investigating whether different functional domains of Arl6ip5 mediate distinct functions (e.g., autophagy induction versus glutamate transport regulation) .

  • Interactome mapping: Comprehensive identification of Arl6ip5 binding partners across different cell types and conditions using techniques like BioID, APEX proximity labeling, or immunoprecipitation coupled with mass spectrometry .

  • Subcellular localization studies: Determining if Arl6ip5 localizes to different compartments under various conditions, potentially explaining its diverse functions .

  • Post-translational modification analysis: Investigating whether specific modifications (phosphorylation, ubiquitination) channel Arl6ip5 into different functional pathways .

  • Systems biology approach: Integrating data from various experimental paradigms into computational models that can predict how Arl6ip5 functions may be prioritized or integrated in different cellular contexts .

These approaches collectively provide a framework for understanding how a single protein can serve multiple functions in a context-dependent manner.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.