Recombinant Rat Probable G-protein coupled receptor 149 (Gpr149)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format requirement, kindly indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All protein shipments are accompanied by standard blue ice packs. If you require dry ice packaging, please notify us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know. We will prioritize developing the specified tag if possible.
Synonyms
Gpr149; Ieda; Probable G-protein coupled receptor 149; Induced early in differentiating astrocytes gene protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-730
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSFFLSNLTNDSRLWKVSHNSTDLMNSPETLTLSLFCLICLMTLVALVGSIFSLVSLLTM QYRTVVSMLVTSWSVDDLLSVLSVAIFMVLQWPREAPGYFQSLCTTSALLYMCQGLSSNL KATLIVFYNFYTMHRTVVSQSSSWRSGQVLGVALTVWAVSLLLASLPLCGWGVFVRTPWG CLTDCSSPYVLLLFAVYASAFGLLAVLSVPLTHQLLCSEEPPRLHANYQEISRGASTPGT PAAGGRVLCLLPEDVEIPALPGTGSSLSSDMVFAPGQPAASSAGAGKRENLWTPRGSSSF PVSLAQKRFALILALTKVILWLPMMIHMVVKHVVGFQSLPVDMLSFLLTLLASTVTPVFV LSKRWAHLPCGCIINCQPDTYSVAFDGKKSKRKGFEFNLSFQQSYGLYKMTHADYYDDDD ENPISYHNPKKYECEATKEPREDNHGVFNTITVEISTTPPLDSATLTGVNKCTNTDIPEP KQAVSEEKGAFSIKTECAINYGEATSFEGPERRLSHEETQKPDLSDWEWCRSKSERTPRQ RSGGGLAIPICAFQGTVSLQAPTGKTLSLSTYEVSAEGQKITPPSKKIEVYRSKSVGHEP NSEESPSTFADTNVKIHLEVLEICDNDEALDTVSIISNISQSSTKVRSPSLRYSRKENRF VSCDLGETASYSLFLPTSDPDGDINISIPDTVEAHRQNSRRQHQDRDGYQEEIQLLNKAY RKREAESKGN
Uniprot No.

Target Background

Function
Orphan receptor.
Gene References Into Functions
  1. Ieda transcripts, induced during the early stages of astrocyte differentiation, were found exclusively in the brain and testis. Expression of Ieda in the developing rat brain was first detected at embryonic day 16, two days before the appearance of mature astrocytes. PMID: 12065666
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed exclusively in brain and testis.

Q&A

What is GPR149 and what are its structural characteristics?

GPR149 is a Class-A, rhodopsin-like G-protein coupled receptor (GPCR) with orthologs found in many vertebrates including mice, rats, and humans. Prediction algorithms suggest it is a 732 amino acid protein with a distinctive structure . Its most unique feature is a highly conserved 360 amino acid C-terminal domain that has no homology to other proteins and may play a crucial role in downstream signaling . Based on phylogenetic analysis of human GPCRs, GPR149 shows closest sequence homology to receptors that utilize peptides as their ligands .

What is the tissue distribution pattern of Gpr149 expression?

Gpr149 demonstrates a distinctive expression pattern with strongest expression in the central nervous system (CNS). Quantitative PCR analysis reveals high expression in the striatum, hypothalamus, brainstem, and spinal cord . The highest non-neuronal expression is found in the pituitary gland . Low expression levels are observed in the gastrointestinal tract and female reproductive organs . Using in situ hybridization techniques, researchers have identified at least 80 brain regions expressing Gpr149 at varying levels, with highest expression in the islands of Calleja, ventromedial hypothalamus, and rostral interpeduncular nucleus .

What experimental models are available for studying Gpr149?

Several transgenic mouse models have been developed to facilitate Gpr149 research:

  • Global Gpr149 knockout mice: Generated using CRISPR-Cas9 technology targeting exon 1, these mice have been used to study the physiological function of Gpr149 in vivo .

  • Gpr149-Cre reporter mouse model: Created by targeting the endogenous Gpr149 locus with Cre-P2A at the ATG start sequence, this model allows for lineage tracing of Gpr149-expressing cells .

  • Gpr149-Cre-tdTomato mice: Used for visualization of Gpr149 expression patterns in combination with fluorescent imaging techniques .

These models serve as essential tools for investigating the biological functions and expression patterns of Gpr149.

What are the recommended protocols for genotyping Gpr149 knockout mice?

For accurate genotyping of Gpr149 knockout mice, researchers should use the following PCR-based protocol:

Primers:

  • Gpr149 1: 5′-GCTGCTTGTAATGTGTGCAGAGAG-3′

  • Gpr149 2: 5′-GTCTACTCATGGCAGACCAAAGTAATGG-3′

  • Gpr149 3: 5′-GTCTCTTGGTGCTAGAGATGGGTG-3′

This protocol yields a wild-type band of 200 bp and a Gpr149 knockout band of 350 bp, allowing for clear differentiation between genotypes . The PCR product should be analyzed on agarose gel electrophoresis with appropriate DNA ladder markers to ensure accurate size determination.

What are the optimal methods for visualizing Gpr149 expression in neural tissues?

For optimal visualization of Gpr149 expression in neural tissues, researchers should consider using a combination of approaches:

  • RNAscope in situ hybridization (ISH): This technique offers high sensitivity and specificity. For Gpr149 detection, both multiplex fluorescent kits (cat# 323110) and chromogenic FastRed kits (Cat#322350) have been successfully employed . The specific Gpr149 probe (cat# 318071) should be applied at 40°C for 2 hours for optimal results.

  • Reporter gene visualization: In Gpr149-Cre-tdTomato mice, native tdTomato fluorescence can be directly imaged after rinsing brain sections in PBS and mounting with ProLong Gold Antifade .

  • Validation with knockout controls: To ensure specificity, parallel processing of tissues from Gpr149-knockout mice is essential to verify the absence of signal in these negative controls .

These methods allow for precise mapping of Gpr149 expression patterns across different brain regions and cell types.

What is known about the role of Gpr149 in energy homeostasis?

Recent research indicates that Gpr149 plays a significant role in energy homeostasis, particularly in male mice . The expression pattern of Gpr149 in key brain regions involved in metabolic regulation—including the ventromedial hypothalamus—strongly suggests its involvement in energy balance pathways . Preliminary metabolic findings from Gpr149-deficient mice support this functional role .

While the exact molecular mechanisms remain to be fully elucidated, the enrichment of Gpr149 in neural circuits controlling basic motivated behaviors, autonomic outflow, and sensory processes suggests it may modulate energy intake, expenditure, or both . Further research using conditional knockout models and metabolic phenotyping approaches will be necessary to define the precise mechanisms by which Gpr149 influences energy homeostasis.

How does Gpr149 influence reproductive function, particularly in females?

Studies have demonstrated that Gpr149 plays an unexpected role in reproductive function, particularly in female mice. Deletion of Gpr149 results in enhanced fertility in female mice, making it one of the few known genetic models with increased reproductive capacity . Specifically, Gpr149 null mice show:

  • Increased fertility

  • Enhanced ovulation

  • Elevated oocyte Gdf9 mRNA levels

  • Increased levels of FSH receptor and cyclin D2 mRNA in granulosa cells

This phenotype suggests that Gpr149 normally functions as a negative regulator of fertility. The mechanism appears to involve modulation of key reproductive hormones and signaling pathways. Interestingly, despite Gpr149 being highly expressed in oocytes, Gpr149 null mice demonstrate normal folliculogenesis, suggesting its role may be modulatory rather than essential for reproductive development .

What signaling pathways are potentially mediated by Gpr149?

The signaling pathways mediated by Gpr149 remain largely uncharacterized, presenting a significant research opportunity. As an orphan receptor, neither its endogenous ligands nor its precise G-protein coupling preferences have been definitively identified .

Several structural features of Gpr149 provide clues about its potential signaling mechanisms:

  • It lacks the first two charged amino acids of the characteristic Asp-Arg-Tyr (DRY) motif found at the end of the third transmembrane helix, which is typically important in G protein coupling .

  • Its highly conserved C-terminal domain differs from other GPCRs and may engage unique downstream effectors .

  • Phylogenetic analysis suggests similarity to peptide-binding GPCRs, hinting at potential ligand classes .

Future research directions could include:

  • Unbiased screening approaches to identify potential ligands

  • G-protein coupling assays using reconstituted systems

  • Identification of protein interaction partners, particularly for the unique C-terminal domain

  • Phosphoproteomic analysis of wild-type versus knockout tissues to identify altered signaling cascades

What are the key considerations when designing experiments to identify the endogenous ligand of Gpr149?

Identifying the endogenous ligand of orphan receptors like Gpr149 represents one of the most challenging aspects of GPCR research. Based on current knowledge of Gpr149, researchers should consider the following approaches:

  • Expression pattern-guided screening: Focus screening efforts on tissues with high Gpr149 expression, particularly brain regions such as the ventromedial hypothalamus and islands of Calleja .

  • Functional assay development: Establish robust cell-based assays that can detect Gpr149 activation. Consider multiple readouts (calcium mobilization, cAMP modulation, β-arrestin recruitment) as the G-protein coupling preference is unknown.

  • Bioinformatic predictions: Utilize the information that Gpr149 shows sequence homology to peptide-binding GPCRs to guide candidate ligand selection .

  • Tissue extracts fractionation: Prepare extracts from tissues with high Gpr149 expression and fractionate them using liquid chromatography before testing fractions in functional assays.

  • Cross-species conservation: Leverage the high conservation of Gpr149 across vertebrates to identify ligands that activate the receptor from multiple species, increasing confidence in physiological relevance.

What controls should be included when validating antibodies or probes for Gpr149 detection?

Proper validation of antibodies and probes for Gpr149 detection is critical for ensuring experimental reliability. Researchers should implement the following controls:

  • Genetic knockout validation: Always include tissues from Gpr149 knockout mice as negative controls when testing antibodies or probes . This is the gold standard for specificity validation.

  • Competitive blocking: For antibody-based detection, include controls where the primary antibody is pre-incubated with the immunizing peptide to demonstrate binding specificity.

  • Cross-validation of methods: Compare results from multiple detection methods (e.g., in situ hybridization, immunohistochemistry, reporter gene expression) to confirm consistent expression patterns .

  • Positive control tissues: Include samples from tissues known to express high levels of Gpr149 (e.g., ventromedial hypothalamus, islands of Calleja) as positive controls .

  • RNAscope probe validation: When using RNAscope for Gpr149 mRNA detection, include both positive control probes for housekeeping genes and negative control probes targeting bacterial sequences to assess assay performance.

How conserved is Gpr149 across species, and what are the implications for translational research?

Gpr149 demonstrates significant evolutionary conservation across vertebrate species, suggesting fundamental biological importance. Phylogenetic analysis reveals clear orthologs in numerous species from fish to mammals . This high degree of conservation has several important implications for translational research:

  • Structural conservation: The distinctive 360 amino acid C-terminal domain of GPR149 is highly conserved, suggesting a critical functional role that has been maintained throughout vertebrate evolution .

  • Functional conservation: The conservation of GPR149 across species suggests that findings in model organisms may have relevance to human biology and potential therapeutic applications.

  • Expression pattern similarities: Comparative studies of Gpr149 expression across species could reveal evolutionarily conserved neural circuits and physiological systems in which this receptor functions.

  • Drug development considerations: The high conservation suggests that compounds targeting rat or mouse Gpr149 might also interact with the human ortholog, facilitating translational research.

Researchers should consider performing comparative analyses of Gpr149 function across species to better understand its fundamental biological roles.

What potential therapeutic applications might emerge from targeting Gpr149?

Given the current understanding of Gpr149 function, several potential therapeutic applications can be envisioned:

  • Fertility enhancement: Since Gpr149 knockout female mice demonstrate enhanced fertility, Gpr149 antagonists could potentially be developed as novel fertility-enhancing agents for assisted reproductive technology applications . This represents a unique opportunity as Gpr149 null mice are one of the few genetic models with increased fertility.

  • Metabolic disorders: The involvement of Gpr149 in energy homeostasis suggests that modulating its activity might offer new approaches for treating metabolic disorders . Further characterization of the metabolic phenotypes of Gpr149-deficient animals will help define specific therapeutic opportunities.

  • Neurological applications: The expression of Gpr149 in specific brain regions and its potential role as a negative regulator of myelinization suggest possible applications in neurological conditions involving myelin dysregulation.

Future research should focus on developing selective Gpr149 modulators and testing their effects in relevant disease models to explore these potential therapeutic applications.

What are the most promising approaches for elucidating the physiological function of Gpr149?

To comprehensively understand the physiological functions of Gpr149, researchers should consider the following integrated approaches:

  • Conditional and tissue-specific knockout models: Generate conditional Gpr149 knockout mice to dissect the role of Gpr149 in specific tissues and developmental stages. The existing Gpr149-Cre mouse model could be valuable for this purpose when crossed with floxed alleles of interest.

  • Chemogenetic and optogenetic manipulation: Use DREADD (Designer Receptors Exclusively Activated by Designer Drugs) or optogenetic techniques in combination with the Gpr149-Cre line to specifically activate or inhibit Gpr149-expressing neurons and assess the resulting physiological effects.

  • Single-cell transcriptomics: Apply single-cell RNA sequencing to Gpr149-expressing cells to identify molecular signatures and potential functional clusters within this population.

  • In vivo physiology: Implement comprehensive metabolic phenotyping, reproductive analysis, and behavioral testing in Gpr149 knockout models under various challenging conditions (e.g., high-fat diet, fasting, stress) to reveal context-dependent functions.

  • Proteomic approaches: Identify protein interaction partners of GPR149, particularly those binding to its unique C-terminal domain, to map its signaling network.

What technical challenges remain in studying Gpr149 function, and how might they be addressed?

Several technical challenges currently limit comprehensive investigation of Gpr149 function:

  • Lack of identified endogenous ligand: The orphan status of Gpr149 presents a major obstacle to studying its activation and signaling. High-throughput screening approaches using biased and unbiased libraries, combined with functional assays, could help identify agonists or antagonists.

  • Limited antibody availability and specificity: Developing well-validated, specific antibodies against GPR149 remains challenging. Alternative approaches such as epitope tagging of endogenous GPR149 using CRISPR-Cas9 genome editing might provide more reliable protein detection.

  • Complex expression pattern: The widespread but variable expression of Gpr149 across numerous brain regions complicates the dissection of its region-specific functions. Circuit-specific manipulations using viral vectors with retrograde or anterograde specificity could help address this complexity.

  • Potential compensatory mechanisms: As with many knockout models, compensatory changes in related signaling pathways could mask the full phenotypic impact of Gpr149 deletion. Acute knockout approaches using inducible systems or pharmacological tools could help minimize these compensatory effects.

  • Translation between model organisms and humans: While Gpr149 is conserved across species, potential differences in expression patterns or signaling mechanisms between rodents and humans require careful consideration for translational research. Comparative studies using human samples and cellular models will be essential for addressing this challenge.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.