Recombinant Rat Probable G-protein coupled receptor 156 (Gpr156)

Shipped with Ice Packs
In Stock

Description

Functional Significance in Auditory and Vestibular Systems

GPR156 regulates hair cell orientation through EMX2-dependent polarization :

  1. Hair cell reversal mechanism:

    • EMX2 triggers apical enrichment of GPR156

    • Signals via Gαi2/3 to reverse stereocilia orientation by 180°

  2. Constitutive activity: Maintains baseline auditory function without ligand activation .

  3. Pathological correlations: Knockout models show complete loss of lateral peak response (LPR) in utricles and saccules .

Research Applications and Tools

Commercial availability facilitates experimental studies:

Expression Systems

VendorProduct CodeFormat
Creative BioMartGPR156-2654RHis-tagged mammalian cell
CUSABIOCSB-CF817004RAE.coli-expressed, no tag

Key Antibodies

ApplicationCloneReactivity
Western BlotCSB-PA002763Human, cross-reactive
ImmunofluorescenceCSB-PA844046LA01HURat-specific

Mechanistic Discoveries

Landmark studies demonstrated:

  1. Non-canonical activation:

    • Absence of ionic lock (K³·⁵⁰-S²⁵⁷⁶·³⁵ vs typical K³·⁵⁰-D/E⁶·³⁵)

    • TM6 remains static during G protein coupling

  2. G protein coupling:

    • Gi3 interaction causes intracellular loop contraction (Δ2.1Å in ICL2)

    • No dimer rearrangement upon G protein binding

Therapeutic Implications

The structural blueprint enables targeted drug development for:

  • Congenital hearing loss (DFNB non-syndromic deafness loci)

  • Balance disorders linked to vestibular hair cell misorientation

Current research focuses on allosteric modulators that exploit the symmetrical active-state dimer interface .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Gpr156; Gababl; Probable G-protein coupled receptor 156; GABAB-related G-protein coupled receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-792
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MEPEINCSEFCDSFPGQELDRRPLHDLCKTTITDSQHGSADISPLSPALLGVIWTFLSCG LLLVLFFLAFTIRCRKNRIVKMSSPNLNIVTLLGSCLTYSSAYLFGIQDALVGSSVEALI QTRLSLLCIGTTLVFGPILGKSWRLYKVFTQRVPDKRVIIKDLQLLGLVAALVVADVILL VTWVLTDPIQCLQILGVSMKVTGRDVSCSLTNTHFCASRYSDVWIALVLGCKGLLLLYGA YLAGLTNHVSSPPVNQSLTIMVGVNLLLLTAGLLFVVTRYLHSWPNLVFGLTSGGIFVCT TTVNCCVFLPQLRQRKAFEGENQTIRHMAKYFSTPSKTFRSKFDEDQSCHLRDEXSCMER LLTEKNAVIESLQEQVSNAKEKLVKLMSAECALDSPEWAVPAAASAGGPAECXATSEKES GAAAEDSLPASAASQHMQGPGASRRDXSPSPDQKYDMPLKQFCDHLDMGCSQKPKAEQSE GPERGNQEPMAPGQSLMTDGVACEPHRPRQNSEVLPERLPRVSSVVREKLQEVLQELDLG TEAPLSPLPCPQQPWKSNTSGSPQKLSPSKLGFSPYVVRRRRAAQRARSRIPGSVGLKMG HQANNTVSGSQNGLIVQNRDSPRLDHHNARSKEPRSSSVKPSPISAPHQRRGSLEGSKQC ETEPQEARGYSVAFPRQPSASAPAQSSTAPCLSSXPALPRQRQPLPLLSPGCPSLSSGCY NLDSESSSSDEFFCRCHRPYCEICFQSSLDSNDSDTSDSDLEQTSGLASWEKLLARSKPV VNFKDDLKPTLV
Uniprot No.

Target Background

Function
Orphan receptor.
Gene References Into Functions
  1. GABAB receptor cell surface stability is modulated by phosphorylation and chronic agonist treatment. PMID: 14707142
Database Links
Protein Families
G-protein coupled receptor 3 family, GABA-B receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed throughout the brain and is particularly dense in the olfactory tubercles, islands of Calleja, nucleus accumbens, piriform cortex and all fields of the hippocampus.

Q&A

What is GPR156 and how does it differ from typical class C GPCRs?

GPR156 is a class C orphan G-protein-coupled receptor with an atypical structure that lacks the large Venus Flytrap (VFT) extracellular domain characteristic of other class C GPCRs. Unlike typical class C receptors, GPR156 possesses an extremely short N-terminal sequence (45 residues) that forms a small extracellular region with Extracellular Loop 2 (ECL2) . This structural difference contributes to its unique activation mechanism and high constitutive activity through Gi2/3 signaling pathways .

How does recombinant rat GPR156 expression compare with native expression patterns?

Native GPR156 is highly expressed in auditory hair cells (HCs) and plays a pivotal role in their functionality and orientation . It is also widely distributed throughout the rat central nervous system, though its physiological function in the CNS remains less characterized .

When producing recombinant rat GPR156, researchers should consider tissue-specific post-translational modifications. Expression systems should be selected based on research objectives:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliCost-effective, high yieldLimited post-translational modificationsStructural studies, antibody production
BaculovirusBetter protein folding, some PTMsMore complex, moderate costFunctional studies, protein-protein interactions
Mammalian cellsNative-like PTMs, proper foldingHigher cost, lower yieldSignaling studies, drug screening
In Vivo BiotinylationSite-specific labelingTechnical complexityProtein interaction studies, pull-down assays

Each system produces proteins with different characteristics that may impact experimental outcomes .

What are the optimal methods for purifying recombinant rat GPR156 while maintaining its native conformation?

Based on successful purification of human GPR156 for cryo-EM studies, the following optimized protocol can be adapted for rat GPR156:

  • Cell Lysis and Membrane Preparation:

    • Harvest cells and disrupt using nitrogen cavitation in buffer containing protease inhibitors

    • Collect membranes by ultracentrifugation (100,000×g for 1h)

  • Solubilization:

    • Solubilize membranes using 1% (w/v) lauryl maltose neopentyl glycol (LMNG) with 0.1% (w/v) cholesteryl hemisuccinate (CHS) for 2h at 4°C

    • Remove insoluble material by ultracentrifugation

  • Affinity Purification:

    • Apply solubilized material to Ni-NTA resin

    • Wash with buffer containing 0.01% (w/v) LMNG, 0.001% (w/v) CHS

    • Elute with imidazole gradient

  • Size Exclusion Chromatography:

    • Further purify using Superose 6 Increase column

    • Buffer composition: 25 mM HEPES pH 7.5, 150 mM NaCl, 0.01% (w/v) LMNG, 0.001% (w/v) CHS

Critical considerations include maintaining cold temperature throughout purification and minimizing time between steps to prevent protein degradation.

How can the constitutive activity of GPR156 be accurately measured in experimental settings?

Two complementary approaches have been validated for measuring GPR156 activity:

  • BRET-based G Protein Dissociation Assay:

    • Transfect cells with GPR156 and BRET biosensor constructs (Gαi-Rluc8, Gβ1, Venus-Gγ2)

    • Measure BRET signal as indicator of constitutive activity

    • Calculate BRET ratio (530nm/480nm) to quantify activity levels

  • NanoBiT-based G Protein Recruitment Assay:

    • Co-express GPR156 fused to LgBiT and Gγ2 fused to SmBiT

    • Measure luminescence signal upon G protein recruitment

    • Normalize to appropriate controls

Both assays should include positive controls (known constitutively active GPCRs) and negative controls (mock-transfected cells) for proper interpretation.

What does the cryo-EM structure reveal about GPR156's atypical activation mechanism?

Recent cryo-EM studies have provided unprecedented insights into GPR156's activation mechanism at resolutions of 3.09 Å (apo state) and 2.40 Å (G-protein-bound state) . Key findings include:

  • Novel Dimer Interface: GPR156 forms a homodimer with a unique TM5/6-TM5/6 interface that remains virtually unchanged between the apo and G-protein-bound states (RMSD of 0.494 Å) .

  • Active State Conformation: Both subunits in the apo state exhibit active-state conformations similar to G-protein-bound GABAB2, with key interactions including:

    • K1413.50 forms hydrogen bonds with N882.39

    • S842.35 and R1443.53 form additional stabilizing hydrogen bonds

    • F1353.44 adopts an active-state conformation

  • Absence of Ionic Lock: Unlike other class C GPCRs, GPR156 has S2576.35 instead of D6.35 or E6.35, preventing the formation of a stable ionic lock with K3.50, which contributes to its constitutive activity .

  • C-terminus Function: The C-terminus plays a dual role - promoting G protein binding in the G-bound subunit while simultaneously preventing additional G protein binding to the G-free subunit .

This structural information explains GPR156's high constitutive activity and provides a foundation for understanding its role in auditory function.

What cellular mechanisms link GPR156 dysfunction to hearing loss?

In vivo knockdown experiments have revealed the temporal importance of GPR156 in auditory function:

  • Developmental Effects: GPR156 knockdown during auditory development (P2-P3) leads to improper stereocilium deflection in hair cells, consistent with its role as a cell polarity determinant .

  • Maintenance Function: Knockdown in mature mice (P30 and P60) resulted in:

    • Severe hearing loss as measured by Auditory Brainstem Response (ABR)

    • Partial loss of hair cells throughout the cochlea

    • These effects were observed despite only ~50% reduction in GPR156 expression levels

The experimental design involved AAV-mediated GPR156-shRNA delivery through the round window membrane, with contralateral ears serving as controls . This demonstrates that GPR156's constitutive activity is essential not only for establishing but also for maintaining auditory function throughout life.

How can mutagenesis studies of recombinant rat GPR156 inform structure-function relationships?

Based on structural insights, the following key residues are prime targets for site-directed mutagenesis to elucidate structure-function relationships:

DomainResidueFunctionMutation StrategyExpected Effect
TM3K1413.50Active state stabilizationK141AReduced constitutive activity
TM3R1443.53Hydrogen bond networkR144AAltered G protein coupling
TM2S842.35Active state stabilizationS84ADecreased basal activity
TM3F1353.44Active conformationF135ADisrupted activation
TM5/TM6 interfaceD2225.37, R2796.57Dimer formationD222A, R279AImpaired dimerization
C-terminusC-terminal residuesG protein regulationTruncation/deletionAltered G protein binding pattern

Mutations affecting the dimer interface (D2225.37 and R2796.57) would be particularly informative, as these residues form electrostatic interactions that tether the extracellular ends of both GPR156 monomers' TMDs .

What methodological approaches can be used to identify potential GPR156 ligands?

Although GPR156 is considered an orphan receptor with high constitutive activity, systematic approaches to identify potential modulators include:

  • High-throughput Screening:

    • Establish stable cell lines expressing recombinant rat GPR156

    • Use BRET or NanoBiT assays to screen compound libraries

    • Focus on compounds that either enhance or inhibit constitutive activity

  • Structure-based Virtual Screening:

    • Utilize the cryo-EM structure to identify potential binding pockets

    • Perform in silico docking of compound libraries

    • Validate top hits using biochemical and cellular assays

  • Lipidomic Analysis:

    • Recent studies identified phosphatidylglycerol (PG) 36:2 (PG (18:1_18:1)) as an endogenous phospholipid bound to GPR156

    • Employ liquid chromatography-mass spectrometry (LC-MS/MS) to identify additional lipid modulators

    • Parameters: MS/MS assigned = TRUE; Total score ≥ 70; detected in all replicates; log2 fold change (logFC) ≥ 2

Successful identification of GPR156 modulators could provide valuable tools for studying its function and potential therapeutic applications for hearing loss.

How can recombinant rat GPR156 be used to investigate hearing loss mechanisms?

Recombinant rat GPR156 serves as a valuable model for investigating hearing loss mechanisms through several experimental approaches:

  • In vitro Functional Reconstitution:

    • Reconstitute purified GPR156 into liposomes with Gi proteins

    • Assess basal and modulator-induced activity

    • Compare wild-type and disease-associated variants

  • Gene Therapy Models:

    • Design AAV vectors expressing wild-type or mutant GPR156

    • Deliver to GPR156-knockdown rodent models via round window membrane

    • Evaluate auditory function recovery using ABR measurements

  • Precision Medicine Applications:

    • Screen patient-derived GPR156 variants for functional defects

    • Develop variant-specific therapeutic approaches based on mechanism of dysfunction

Recent studies demonstrating GPR156's essential role in both establishing and maintaining auditory function highlight its potential as a therapeutic target for congenital hearing loss .

What considerations are important when translating findings between rat and human GPR156?

When translating findings between species, researchers should consider:

  • Sequence Homology: Human and rat GPR156 share significant sequence homology but contain important differences that may affect:

    • G protein coupling specificity

    • Constitutive activity levels

    • Response to potential modulators

  • Expression Patterns:

    • In humans, GPR156 variants are associated with recessive congenital hearing loss (DFNB121)

    • Comparative expression studies should examine species differences in tissue distribution

  • Structural Conservation:

    • Key structural features like the TM5/6-TM5/6 dimer interface appear conserved

    • The C-terminus dual regulatory function may have species-specific aspects

  • Experimental Design:

    • Include both rat and human GPR156 in parallel experiments when possible

    • Validate findings in human cell models or tissues before clinical translation

Understanding these considerations will improve the translational relevance of findings from rat GPR156 studies to human auditory pathologies.

What computational methods are most suitable for modeling GPR156 dynamics?

Based on recent research, the following computational approaches are recommended:

  • Molecular Dynamics Simulations:

    • System preparation: Embed GPR156 dimer in a 3:1 POPC:POPE and cholesterol bilayer

    • Parameters: Use CHARMM36m forcefield with TIP3P water model and 0.15 M Na+/Cl- ions

    • Equilibration: 5000 steps energy minimization, 250 ps NVT at 310 K, 1.5 ns NPT at 1 atm

    • Production: Multiple replicates with different initial velocities

    • Analysis: Cavity volume calculation with Epock (1.0.5) in VMD

  • Key Simulation Parameters:

    • Long-range electrostatics: Particle-mesh Ewald method

    • Short-range electrostatic and van der Waals interactions: 10 Å cutoff

    • Bond constraints: LINCS algorithm

    • Software: GROMACS-2019.4 or newer

These approaches can provide insights into conformational dynamics not directly observable in static cryo-EM structures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.