Recombinant Rat Probable G-protein coupled receptor 160 (Gpr160)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format readily available in our inventory, we are happy to accommodate your specific format requirements. Please indicate your preferred format when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize its development.
Synonyms
Gpr160; Probable G-protein coupled receptor 160
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MTALPSKNCSFQYQSHQAPRSLDATCLLLLIILGKVLLNVLILRVKRKDTSWSFMEYFCF SLALVDLLLLVNISVLTYFRDFVVLGIRFTNYHICLLTQIVSFAYGFLHYPVCSLACIDY WCNLSRATKPSSRWQKLLYLLTVILTWISVLAYVLGDPAISASLKTHKTSVNQCPSYVST QSHWLSLSMLMILSVAFLISWQEVVALIQAIRIASYKNKAVLYFPFPPHTSYTVSPRAVL LPRLIVCFLGTWFPFVALQVLILSLRVQIPAYIEMNVPWLYFVNSFLIAAVYWFNCHKLY WRDGMFPVDPFINWKCCFVPVHRLKQVERPMSIIIC
Uniprot No.

Target Background

Function
Orphan receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the neuroanatomical distribution of Gpr160 in the rat brain?

Gpr160-like immunoreactivity (Gpr160ir) has been detected in multiple discrete regions throughout the rat brain that overlap with areas known to contain CART peptides. Specifically, Gpr160ir is observed throughout the rostrocaudal extent of the nucleus tractus solitarius (NTS), with dense staining lateral to the area postrema (AP), while relatively less staining appears in the commissural NTS . Additionally, Gpr160ir is diffusely present within the AP itself .

Other important nuclei where Gpr160ir has been detected include:

  • Parabrachial nucleus

  • Hypoglossal nucleus

  • Arcuate nucleus (ARC)

  • Paraventricular nucleus (PVN)

  • Nucleus accumbens shell (notably absent from the nucleus accumbens core)

  • Substantia nigra (absent from the ventral tegmental area)

  • Amygdala

  • Hippocampus (following the hippocampal CA1, CA2, and CA3 areas to the dentate gyrus)

  • Retrochiasmatic area (RCA)

This distribution pattern provides critical guidance for site-specific studies targeting discrete brain areas to determine physiological functions of this receptor.

What cellular populations express Gpr160?

Gpr160 expression is not limited to neurons but extends to multiple cell types in the central nervous system. Immunohistochemical analysis has confirmed that Gpr160ir is present in both neuronal and non-neuronal cell types throughout the rat brain . Validation studies using RNAscope technology have localized Gpr160 not only to neurons but also to microglia and astrocytes . This diverse cellular expression pattern suggests that Gpr160 may mediate complex intercellular signaling networks involving both neuronal and glial populations, potentially explaining its multifaceted roles in nociception and ingestive behaviors.

What is the proposed ligand for Gpr160 and how was this determined?

Cocaine- and amphetamine-regulated transcript peptide (CARTp) has been identified as a potential ligand for Gpr160. This association was established through multiple complementary methodologies:

  • Co-immunoprecipitation studies demonstrating that Gpr160 immunoreactivity co-precipitates with FAM-labeled CARTp

  • Proximity ligation assays showing colocalization of CARTp with Gpr160 on cells

  • Functional studies where CARTp-induced effects (increased cFos in KATO III cells and ERK phosphorylation in differentiated PC-12 cells) were significantly compromised by prior siRNA treatment targeting Gpr160

  • In vivo studies demonstrating that passive immunoneutralization of Gpr160 blocked CARTp-induced inhibition of food and water intake

  • Knockout studies showing that Gpr160 KO mice do not develop behavioral hypersensitivities after intrathecal or intraplantar injections of CARTp

While these findings strongly support CARTp as a ligand for Gpr160, researchers should consider that other feeding-related peptides may potentially interact with the same receptor, and further studies using proximity ligation assays and other methods for assessing physical association between proteins are warranted .

What validated antibodies are available for studying Gpr160 and how were they characterized?

A well-characterized antibody (Pa5-33650, Thermo Fisher Scientific) targeting the second extracellular loop of Gpr160 has been validated through multiple approaches:

  • Functional validation: The antibody effectively prevented CARTp from accessing potential binding sites in passive immunoneutralization studies

  • Cellular validation: The same antibody used for in vivo passive neutralization was effective for immunohistochemical staining, representing the same binding sites disrupted during behavioral experiments

  • Molecular validation: Multiple validation approaches demonstrated specificity, including:

    • siRNA knockdown studies showing diminished CARTp actions in cells treated with Gpr160-targeting siRNA

    • Co-immunoprecipitation of the antibody with FAM-labeled CARTp

    • Proximity ligation assays showing colocalization

    • Western blotting and immunofluorescence confirmation of decreased Gpr160 protein levels following siRNA treatment

Researchers should note potential limitations: the antibody may potentially interact with epitopes shared with other G-protein coupled receptors due to homologies among members of this receptor class . Definitive specificity would require expression studies in cells null for other receptors, demonstrating ligand binding and signaling that is specifically interrupted by the Gpr160 antibody.

What methodologies are effective for loss-of-function studies of Gpr160?

Multiple validated approaches have been used for Gpr160 loss-of-function studies:

1. Passive Immunoneutralization:

  • Implementation: Injection of 2 μg of Gpr160 antiserum into the fourth cerebroventricle (4V) targeting the second extracellular loop to prevent CARTp from accessing potential binding sites

  • Validation: This approach successfully blocked CARTp's effects on both food and water intake

  • Timeline: Administration at 1700h, with subsequent CARTp or vehicle administration at 1730h, and measurements conducted at 30-minute intervals

2. siRNA Knockdown:

  • Implementation: Targeted siRNA treatment in cell lines (KATO III and differentiated PC-12 cells)

  • Validation: Demonstrated by Western blotting and immunofluorescence showing decreased Gpr160 protein levels

  • Applications: Effective in reducing CARTp-induced cFos expression and ERK phosphorylation

3. CRISPR-Cas9 Global Knockout:

  • Implementation: Generation of global Gpr160 knockout mice using CRISPR-Cas9 genome editing technology

  • Validation: Confirmed by appropriate genotyping methods

  • Phenotype: KO mice are healthy and fertile with no observable physical abnormalities, making them viable models for functional studies

Each approach has distinct advantages depending on research questions: immunoneutralization allows acute, region-specific blockade; siRNA provides cellular-level temporal control; while genetic knockout offers complete absence of the receptor for comprehensive physiological assessment.

How should researchers design behavioral experiments to assess Gpr160 function in nociception?

Based on published experimental designs, the following methodological approach is recommended for studying Gpr160's role in nociception:

Experimental Models:

  • Neuropathic pain model: Constriction of the sciatic nerve, which has demonstrated clear differences between Gpr160 KO and control mice

  • Acute pain models: Hot-plate and tail-flick assays, though these have shown no differences between Gpr160 KO and control mice

  • CARTp-induced pain models: Intrathecal or intraplantar injections of CARTp to assess Gpr160-dependent behavioral hypersensitivities

Control Considerations:

  • Sex differences: Studies to date have acknowledged limitations of male-only investigations; future designs should include both sexes

  • Appropriate controls: For knockout studies, age-matched and sex-matched control floxed mice

  • For pharmacological studies: Proper vehicle controls and counterbalanced design

Measurement Parameters:

  • Time course: Serial measurements at defined time points (e.g., 30-minute intervals) to capture temporal dynamics of responses

  • Multiple pain modalities: Assessment of mechanical and thermal hypersensitivity

  • Baseline measurements: Establish pre-intervention baselines for each subject

Data Analysis:

  • Two-way ANOVA for time versus treatment interactions to assess temporal effects

  • Analysis for both time effects and treatment effects independently

This comprehensive approach enables robust assessment of Gpr160's role in various pain states while controlling for potential confounding variables.

What is the functional relationship between Gpr160 signaling and GLP-1 receptor pathways in food intake regulation?

Studies have revealed a complex interaction between Gpr160 and glucagon-like peptide 1 (GLP-1) signaling pathways in the regulation of food intake but not water intake:

  • The decrease in food intake caused by central injection of CARTp is interrupted by prior administration of a GLP-1 receptor antagonist

  • This relationship appears to be specific to food intake, as the CARTp-induced reduction in water intake is not affected by GLP-1 receptor antagonism

  • This dissociation suggests separate downstream mechanisms for CARTp's anorexigenic versus antidipsogenic effects, with the former being GLP-1 receptor-dependent and the latter GLP-1 receptor-independent

These findings point to a hierarchical organization where CARTp-Gpr160 signaling may activate GLP-1 receptors to mediate anorexigenic effects, while utilizing different downstream mediators for water intake regulation. Future research directions should explore:

  • The neuroanatomical overlap between Gpr160 and GLP-1 receptor expression

  • Potential direct interactions between these signaling systems

  • The molecular mechanisms by which Gpr160 activation might influence GLP-1 receptor function

What signaling pathways are activated downstream of Gpr160 stimulation?

While research on Gpr160 signaling pathways remains developing, experimental evidence indicates several potential downstream mechanisms:

  • ERK Phosphorylation: CARTp induces ERK phosphorylation in differentiated PC-12 cells, which is significantly reduced by prior siRNA treatment targeting Gpr160

  • cFos Activation: CARTp increases cFos in KATO III cells, an effect compromised by Gpr160 siRNA treatment

The activation of cFos indicates Gpr160 stimulation may influence gene expression through immediate early gene activation, potentially leading to longer-term neuroplastic changes relevant to both feeding behavior and nociception.

What phenotypic differences exist between global Gpr160 knockout models and region-specific knockdown approaches?

Comparison of global genetic knockout versus region-specific approaches reveals important distinctions in understanding Gpr160 function:

Global Gpr160 Knockout Phenotypes:

  • Viable and fertile with no observable physical abnormalities

  • Fail to develop behavioral hypersensitivities in neuropathic pain models

  • Normal responses in acute pain models (hot-plate and tail-flick assays)

  • Resistant to CARTp-induced behavioral hypersensitivities

  • No differences in learning, memory, or anxiety compared to control mice

Region-Specific Gpr160 Blockade Phenotypes:

  • Fourth ventricle (4V) Gpr160 immunoneutralization blocks CARTp-induced inhibition of both food and water intake

  • Blockade of Gpr160 in the 4V, independent of CARTp treatment, increases overnight food and water intake

This comparison suggests regional specificity in Gpr160 function, where:

  • Brainstem Gpr160 (accessible via 4V) appears critical for ingestive behavior regulation

  • Global knockout affects pain processing but preserves normal acute nociception

  • Developmental compensation may occur in global knockout models but not in acute regional blockade

These differences underscore the importance of utilizing complementary approaches (genetic, pharmacological, and region-specific) to fully characterize Gpr160 function across physiological systems.

How can researchers address potential cross-reactivity concerns with Gpr160 antibodies?

The significant homology among G-protein coupled receptors presents challenges for antibody specificity. Researchers should implement the following validation protocol to address cross-reactivity concerns:

  • Multiple antibody validation approaches:

    • Molecular: Western blotting with appropriate controls

    • Cellular: Immunofluorescence localization

    • Functional: Demonstration that antibody blocks known ligand effects

    • Genetic: Testing antibody in knockout/knockdown models

  • Epitope mapping and bioinformatic analysis:

    • Computational analysis of antibody epitopes for potential cross-reactivity

    • Sequence alignment with related GPCRs to identify shared motifs

  • Complementary techniques for confirmation:

    • RNAscope or in situ hybridization to confirm protein expression matches mRNA distribution

    • Mass spectrometry to confirm immunoprecipitated proteins

    • Heterologous expression systems to test antibody specificity against defined targets

  • Rigorous controls:

    • Pre-absorption controls with immunizing peptide

    • Testing in tissues known to be negative for Gpr160

    • Secondary antibody-only controls

As noted in the literature, "only when each potential candidate [receptor] is expressed in cells null for the other receptors might this be established by detection of ligand (CARTp) binding and by demonstrating that signaling through that other receptor is not interrupted by the Gpr160 antibody" .

What experimental approaches can resolve inconsistencies in Gpr160 function across different physiological systems?

To address potentially conflicting results regarding Gpr160 function across physiological systems (feeding, pain, etc.), implement these methodological solutions:

  • System-specific genetic approaches:

    • Conditional knockout models using Cre-lox systems with tissue-specific promoters

    • Inducible expression systems to control temporal aspects of Gpr160 manipulation

    • Region-specific viral vector delivery of shRNA or CRISPR-Cas9 components

  • Multi-modal physiological assessment:

    • Simultaneous measurement of multiple parameters (feeding, pain, activity)

    • Time-course studies to capture dynamic changes in different systems

    • Dose-response relationships for pharmacological manipulations

  • Mechanistic dissection:

    • Pathway-specific pharmacological inhibitors to isolate downstream mediators

    • Chemogenetic or optogenetic approaches for circuit-specific manipulation

    • Ex vivo slice recordings to assess cellular responses to CARTp in presence/absence of Gpr160

  • Sex-specific and developmental considerations:

    • Parallel studies in male and female animals across estrous cycle stages

    • Age-dependent assessments from juvenile to adult stages

    • Consideration of potential compensatory mechanisms in chronic versus acute manipulations

The literature acknowledges limitations of male-only studies and emphasizes "future studies must address similar issues in female animals... across all 4 days of the estrous cycle using transgenic animals designed for that purpose" .

Food and Water Intake Data in Gpr160 Manipulation Studies

Based on published experimental findings, the following data summarize the effects of Gpr160 manipulation on ingestive behaviors:

Table 1. Effects of Gpr160 Manipulation on Food and Water Intake

Treatment GroupFood Intake (g/18h)Water Intake (ml/18h)Statistical Significance
Control + VehicleBaselineBaselineReference group
Control + CARTpSignificantly reducedSignificantly reducedp < 0.0001 vs. Control + Vehicle
Anti-Gpr160 + VehicleSignificantly increasedSignificantly increasedp < 0.01 vs. Control + Vehicle
Anti-Gpr160 + CARTpNo significant reductionNo significant reductionp > 0.05 vs. Anti-Gpr160 + Vehicle

Statistical analysis of these data revealed:

  • Significant time versus treatment interactions for food intake (F15,228 = 2.86, p < 0.001)

  • Significant time effects (F5,228 = 161.8, p < 0.0001) and treatment effects (F3,228 = 18.76, p < 0.0001) for food intake

  • Significant time versus treatment interactions for water intake (F15,228 = 2.21, p < 0.01)

  • Significant time effects (F5,228 = 120.6, p < 0.0001) and treatment effects (F3,228 = 22.09, p < 0.0001) for water intake

These data demonstrate that passive immunoneutralization of Gpr160 not only blocks CARTp-induced reduction in food and water intake but also increases baseline ingestive behaviors, suggesting tonic inhibitory regulation by endogenous CARTp-Gpr160 signaling.

Neuroanatomical Distribution of Gpr160 Immunoreactivity

The following table summarizes the distribution pattern and relative intensity of Gpr160 immunoreactivity across brain regions:

Table 2. Regional Distribution of Gpr160 Immunoreactivity in Rat Brain

Brain RegionGpr160 ImmunoreactivityFunctional Relevance
Nucleus Tractus Solitarius (NTS)+++ (Throughout rostrocaudal extent)Visceral sensory processing; feeding regulation
Area Postrema (AP)++ (Diffuse)Circumventricular organ; chemosensing
Parabrachial Nucleus+++Taste; feeding; pain processing
Hypoglossal Nucleus++Motor control of tongue
Arcuate Nucleus (ARC)+++Energy homeostasis; feeding regulation
Paraventricular Nucleus (PVN)+++Neuroendocrine control; stress responses
Nucleus Accumbens Shell+++Reward processing
Nucleus Accumbens Core- (Not detected)Reward processing
Substantia Nigra+++Motor control
Ventral Tegmental Area- (Not detected)Reward; motivation
Amygdala+++Emotional processing; fear conditioning
Hippocampus (CA1-CA3, Dentate Gyrus)++Learning; memory
Retrochiasmatic Area (RCA)++Reproductive function; feeding

Key: +++ (High), ++ (Moderate), + (Low), - (Not detected)

This distribution pattern reveals preferential localization in regions associated with feeding regulation, reward processing, and nociception, consistent with the observed functional roles of Gpr160 in these physiological processes.

What genetic approaches would advance understanding of Gpr160 function in specific neural circuits?

Current genetic tools provide promising approaches to advance Gpr160 research:

  • Cell-type specific conditional knockouts:

    • Develop Gpr160-floxed mice crossed with cell-type specific Cre lines (e.g., TH-Cre, POMC-Cre, GFAP-Cre) to selectively delete Gpr160 in specific neuronal or glial populations

    • This would help delineate the relative contributions of Gpr160 in different cell types to physiological functions

  • Circuit-specific manipulations:

    • Implement Cre-dependent viral strategies to manipulate Gpr160 expression in specific projections

    • Combine with retrograde tracers to target Gpr160 manipulation in specific circuit elements

  • Temporal control systems:

    • Develop tamoxifen-inducible Gpr160 knockout models to avoid developmental compensation

    • Implement tetracycline-controllable expression systems for reversible manipulation

  • Reporter strategies:

    • Generate Gpr160-Cre or Gpr160-CreERT2 knock-in mice to enable selective targeting of Gpr160-expressing cells

    • Develop Gpr160-GFP fusion proteins for live visualization of receptor trafficking

  • CRISPR base editing approaches:

    • Implement point mutations in specific domains to dissect structure-function relationships

    • Target regulatory regions to understand transcriptional control of Gpr160 expression

These genetic tools would address current limitations and enable precise dissection of Gpr160 function across neural circuits and physiological systems.

How might Gpr160 be involved in the integration of pain and feeding regulatory systems?

The dual role of Gpr160 in both nociception and feeding regulation suggests it may function as an integrative signaling node connecting these physiological systems:

  • Neuroanatomical convergence:

    • Gpr160 is expressed in regions that process both pain and feeding signals, including the parabrachial nucleus and nucleus tractus solitarius

    • These regions serve as integrative hubs where nociceptive and visceral signals converge

  • Shared molecular mediators:

    • CARTp, the putative Gpr160 ligand, modulates both feeding and pain processing

    • GLP-1 signaling, which interacts with Gpr160-mediated feeding suppression, also modulates pain sensitivity

  • Potential integrative mechanisms:

    • Gpr160 may activate distinct signaling pathways in different neural populations

    • Cell-type specific expression patterns may determine functional outcomes

    • Receptor heteromerization with other GPCRs may provide context-specific signaling

  • Evolutionary perspective:

    • Integration of pain and feeding systems would be evolutionarily advantageous, allowing coordinated responses to environmental challenges

    • Gpr160 may represent a molecular adaptation enabling such integration

Future research should investigate whether stress-induced analgesia or pain-induced anorexia involve Gpr160 signaling, and whether targeted Gpr160 manipulations in specific circuits can bidirectionally modulate these phenomena.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.