Recombinant Rat Probable G-protein coupled receptor 37 (Gpr37)

Shipped with Ice Packs
In Stock

Description

Production and Characteristics of Recombinant Rat GPR37

Recombinant rat GPR37 is synthesized using heterologous expression systems, often in E. coli or mammalian cells, to produce functional protein for biochemical and pharmacological studies. Key features include:

AttributeDetailsSource
SourceE. coli (common for bacterial expression) or mammalian cells (e.g., HEK293)
TagHis-tag (common for purification) or GST-tag (for protein interactions)
Purity>90% (SDS-PAGE validation)
Protein LengthFull-length (aa 27–600 for rodent orthologs) or truncated forms
FormLyophilized powder or solution (Tris/PBS buffer with trehalose)
Storage-20°C/-80°C (avoid repeated freeze-thaw cycles)

Notes:

  • Rat GPR37 shares ~68% amino acid identity with human GPR37 in extracellular domains .

  • Truncated variants (e.g., Δ1-210) enhance surface expression in heterologous systems .

Functional Roles of GPR37 in Rodent Models

GPR37 binds neuroprotective ligands like prosaposin (a sulfated glycoprotein) and modulates signaling pathways critical for neuronal survival and CNS function:

Neuroprotective Mechanisms

  • Prosaposin Binding: GPR37 mediates prosaposin’s anti-apoptotic effects via activation of PI3K/Akt signaling, reducing oxidative stress-induced neuronal death .

  • Parkinson’s Disease: GPR37 knockout mice resist MPTP-induced neurotoxicity, suggesting its role in dopaminergic neuron survival .

Signaling Pathways

GPR37 couples to Gαi/o proteins, inhibiting adenylyl cyclase (reducing cAMP) and activating ERK/MAPK pathways . Key interactions include:

  • PDZ Scaffolds: Binds syntenin-1, enhancing surface expression and trafficking .

  • Autophagy Regulation: Overexpression induces autophagy, linked to Parkinson’s pathology .

Proteolytic Processing

  • N-Terminal Cleavage: GPR37 undergoes metalloproteinase-mediated cleavage (E167-Q168), releasing a soluble ectodomain. This truncated form predominates at the cell surface .

  • O-Glycosylation: Identified in secretomes of HEK293 and synaptosomes, modulating receptor stability and signaling .

Therapeutic Applications

  • Intranasal Prosaposin: Attenuates neuronal apoptosis in stroke models via GPR37/PI3K/Akt signaling .

  • Cancer Research: GPR37 upregulation in gliomas promotes proliferation and survival, suggesting therapeutic targeting .

Table 1: GPR37 Signaling Pathways

PathwayMechanismOutcomeSource
PI3K/AktActivation via Gαi/o-coupled receptorsInhibition of apoptosis
ERK PhosphorylationPertussis toxin-sensitive, GPR37-dependentCell survival, migration
cAMP InhibitionAdenylyl cyclase suppressionReduced intracellular cAMP levels

Table 2: Experimental Models and GPR37 Outcomes

ModelGPR37 InterventionObservationSource
MCAO StrokerPSAP (prosaposin) treatmentReduced neuronal apoptosis, improved motor function
HEK293 CellsΔ1-210 GPR37 truncationEnhanced surface expression
PD Mouse ModelsGPR37 KOResistance to MPTP neurotoxicity

Applications and Future Directions

  • Drug Discovery: Targeting GPR37 with small molecules or biologics to modulate neuroprotection.

  • Biomarker Development: Assessing GPR37 levels in neurodegenerative diseases.

  • Optogenetics: Engineering opto-GPR37 for precise signaling activation in in vivo models .

References

  1. Creativebiomart: Recombinant Mouse GPR37 (His-tagged) .

  2. JCS: GPR37 N-terminal proteolysis .

  3. PMC: Prosaposin neuroprotection via GPR37/PI3K/Akt .

  4. PNAS: Prosaposin-GPR37 signaling .

  5. Emory PDF: GPR37 trafficking mutants .

  6. R&D Systems: Human GPR37 background .

  7. PMC: GPR37 in cancer and neuroprotection .

  8. Cusabio: Rat GPR37 recombinant proteins .

  9. Wikipedia: GPR37 interactions and expression .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gpr37; Prosaposin receptor GPR37; G-protein coupled receptor 37; G-protein coupled receptor CNS1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-603
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
ALSFVPEPRNGTCLGESCSPLIPRRSRDAGGPRNSARDALRVHVPREKLEAEVRGATSWD LPPPRGGDTGVIEEAAASGPLGPPTKPPGAWRWKGAQGKEPSGHLGRREPTDSQLFRQTS ERGEMSSKRDEIPQGSQEHSVKTEPEPRDLFYWPRKTGQLQGSHYRPSAVHEGRTLAPPG RALPQNGSADDWVPDQGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGI IGNLAVMCIVCHNYYMRSISNSLLANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKI VPYIEVASLGVTTFTLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALP EVVLRQLSKEDLGFSGQAPAERCVIKISPDLPDTIYVLALTYDGARLWWYFGCYFCLPTL FTITCSLVTARKIRKAEKASTRGNKRQIHLESQMNCTVVALTILYGFCIIPENICNIVTA YMATGVSQQTMDLLNIISQFLLFFKSCVTPVLLFCLCRPFSRAFMECCCCCCEECIQKSS TVTSDDNDNEYTTELELSPFSTIRREMSTFASVGTHC
Uniprot No.

Target Background

Function
This protein acts as a receptor for the neuroprotective and glioprotective factor prosaposin. Binding of the ligand triggers endocytosis followed by an ERK phosphorylation cascade.
Gene References Into Functions
  1. The expression of Pael-R genes within the nigro-striatal pathway may hold significant implications for the understanding and treatment of Parkinson's disease. PMID: 12618056
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the brain. High levels of expression were seen in fiber tracts such as the corpus callosum, anterior commissure, fornix, internal capsule, cerebral peduncles, and stria terminalis. Additionally, moderate levels of expression were seen

Q&A

What is the expression profile of GPR37 in the rat central nervous system?

GPR37 is highly expressed throughout the central nervous system (CNS), with particularly notable expression in the spinal cord and oligodendrocytes. The receptor shows region-specific distribution patterns across brain structures, with significant expression in myelin-rich areas. For effective characterization in rat models, researchers should employ quantitative PCR and immunohistochemistry using validated antibodies targeting the C-terminal domain of GPR37, as this region remains intact after proteolytic processing. Western blotting analysis typically reveals multiple forms of the receptor (30-60 kDa) due to post-translational modifications and proteolytic processing .

What are the key structural features of rat GPR37 and how do they compare to human GPR37?

Rat GPR37 shares approximately 83% sequence homology with human GPR37, with the highest conservation in the transmembrane domains. Like its human counterpart, rat GPR37 contains a notably long N-terminal domain (approximately 260 amino acids) that undergoes proteolytic processing by ADAM-10. The N-terminus domain is crucial for ligand binding, while the C-terminus interacts with intracellular proteins containing PDZ domains. The receptor contains multiple glycosylation sites in the N-terminus that affect proper folding and cell surface expression. Researchers should note that misfolding of GPR37 occurs frequently when overexpressed in heterologous systems, requiring optimization of expression conditions and potentially the use of molecular chaperones to enhance functional studies .

What model systems are best suited for studying recombinant rat GPR37?

When selecting model systems for recombinant rat GPR37 research, consider these methodological approaches:

Model SystemAdvantagesLimitationsBest Applications
HEK293 cellsEasy transfection, widely used for GPCRsHigh risk of misfolding when overexpressedInitial signaling studies with careful optimization
Primary oligodendrocytesPhysiologically relevantTechnical challenges in isolation and cultureMyelination studies, natural ligand identification
Rat PC12 cellsNeuronal-like propertiesLimited expression of endogenous GPR37 partnersProtein-protein interaction studies
Brain slice culturesPreserves tissue architectureShort experimental windowElectrophysiology, local circuit effects
Conditional knockdown ratsTissue-specific modulationResource-intensiveIn vivo disease modeling

For successful expression of functional recombinant rat GPR37, co-expression with molecular chaperones like HSJ1b is recommended to prevent endoplasmic reticulum (ER) stress and aggregation. Researchers should validate surface expression using immunocytochemistry and biotinylation assays before proceeding with functional studies .

What are the optimal conditions for expressing recombinant rat GPR37 in heterologous systems?

Expression of recombinant rat GPR37 requires careful optimization to overcome inherent challenges with protein misfolding and aggregation. Implement the following methodological approach:

  • Expression vector selection: Use vectors with tunable promoters (such as tetracycline-inducible systems) to control expression levels.

  • Cell line optimization: While HEK293 cells are commonly used, N2a or SH-SY5Y neuroblastoma cells may provide more physiologically relevant cellular machinery for proper folding.

  • Temperature modulation: Lower the incubation temperature to 30-32°C during protein expression to reduce aggregation and improve folding.

  • Co-expression strategies: Always co-express with molecular chaperones like HSJ1b or PDI to prevent ER stress and aggregation.

  • Fusion tag selection: C-terminal tags are preferable to N-terminal tags due to the N-terminal proteolytic processing of GPR37. Commonly used tags include Luciferase for BRET assays or fluorescent proteins for trafficking studies.

  • Expression validation: Confirm surface expression using biotinylation assays or confocal microscopy before proceeding with functional studies.

In reported studies, transfection efficiency of 60-70% with 40-50% surface expression is considered acceptable for most functional assays .

How can researchers effectively measure GPR37 signaling activity in experimental settings?

GPR37 primarily signals through Gαi/o proteins, requiring specialized assays to accurately capture its activity. Implement these methodological approaches:

  • cAMP inhibition assay: Measure the inhibition of forskolin-stimulated cAMP production using BRET or FRET-based biosensors. Typical EC50 values for known modulators range from 3-10 nM.

  • ERK phosphorylation: Western blot analysis of ERK1/2 phosphorylation status at different time points (5-60 min) post-stimulation provides a readout of downstream signaling.

  • Calcium flux assays: Co-express Gα16 with GPR37 to redirect signaling to calcium mobilization, measurable with fluorescent calcium indicators.

  • β-arrestin recruitment: BRET-based assays using GPR37-Rluc and β-arrestin-YFP constructs can measure receptor internalization and β-arrestin signaling.

  • Pertussis toxin sensitivity: Always include pertussis toxin controls (200 ng/ml, 16-24h pre-treatment) to confirm Gαi/o-mediated signaling.

  • GTPγS binding assay: Measures G protein activation directly using radiolabeled GTPγS in membrane preparations.

For all assays, include positive controls (e.g., cells expressing dopamine D2 receptors) and negative controls (untransfected cells or cells expressing an unrelated GPCR) to validate experimental systems .

What approaches should be used to identify and validate potential ligands for rat GPR37?

As an orphan receptor, GPR37 ligand identification remains challenging. Implement this systematic approach:

  • Bioinformatic analysis: Leverage phylogenetic relationships with other GPCRs to identify candidate ligands. GPR37 shows sequence homology with peptide-specific GPCRs.

  • Candidate testing: Screen head activator (HA) peptide (reported EC50: 3.3 nM) and osteocalcin (OCN) (reported EC50: 10.2 nM) as potential ligands using concentration ranges of 0.1 nM to 10 μM.

  • Unbiased screening approaches:

    • Tissue extract fractionation from myelin-rich regions

    • Secretome analysis from oligodendrocytes

    • Reverse pharmacology with compound libraries

  • Validation criteria for ligand confirmation:

    • Dose-dependent response (full concentration-response curves)

    • Specificity (activity in GPR37-expressing cells vs. control cells)

    • Blockade by competitive antagonists or receptor knockdown

    • Pertussis toxin sensitivity to confirm Gαi/o involvement

    • Demonstration of binding using radioligand binding assays

  • Functional relevance testing in physiologically relevant models:

    • Primary oligodendrocytes for myelination effects

    • Microglia for inflammatory responses

    • Neuron-glia co-cultures for neuroprotective effects

In validating OCN as a GPR37 ligand, researchers observed dose-dependent inhibition of cAMP with an EC50 of 10.2 nM, activation of ERK phosphorylation, and functional responses in oligodendrocyte differentiation that were absent in GPR37-deficient cells .

How does GPR37 processing differ across neurodegenerative disease models?

GPR37 processing exhibits disease-specific patterns across various neurodegenerative conditions, providing potential diagnostic and prognostic value. The methodological approach to studying these differences includes:

  • Western blot analysis of brain tissue from different disease models using antibodies targeting different regions of GPR37. Typically visualize:

    • Full-length receptor (~60 kDa)

    • N-terminus processed forms (~45-52 kDa)

    • C-terminal fragments (~30 kDa)

  • Comparative processing patterns:

DiseaseBrain RegionGPR37 Processing PatternPotential Mechanism
Lewy Body Disease (Early)PFC, StriatumIncreased processing, ↑52 kDa formEnhanced ADAM-10 activity
Multiple System AtrophyStriatumOnly 52 kDa form presentAltered degradation pathways
Alzheimer's DiseaseStriatumElevated 52 kDa formInflammation-mediated processing
CBD/PSPAll regionsUnchanged processingN/A
  • CSF biomarker analysis: Measure ecto-GPR37 peptides using nanoluciferase-based immunoassay in CSF from different patient groups. In PD patients with slow disease progression, CSF ecto-GPR37 levels are significantly elevated compared to rapid progressors, suggesting potential prognostic value .

  • Correlative analysis with disease markers: Analyze the relationship between GPR37 processing and established disease markers (α-synuclein, tau, Aβ) to understand the mechanisms underlying altered processing.

Researchers should employ post-mortem tissue with minimal delay between death and tissue processing (<24h) and age/gender-matched controls for accurate analysis of disease-specific changes .

What is the role of GPR37 in Parkinson's disease models and how can it be therapeutically targeted?

GPR37 plays multiple roles in Parkinson's disease pathophysiology, offering several potential therapeutic intervention points:

  • Misfolded protein aggregation: GPR37 is prominently found within Lewy bodies. Mutations in GPR37 are implicated in endoplasmic reticulum stress leading to loss-of-function effects that exacerbate dopaminergic neuron death. Methodological approach:

    • Use immunohistochemistry with specific anti-GPR37 antibodies to co-localize with α-synuclein in Lewy bodies

    • Employ proteasome inhibitors (MG132, 10 μM) to model PD-related protein aggregation in vitro

    • Test chemical chaperones like 4-PBA (5 mM) to prevent GPR37 misfolding

  • Neuroprotective strategies:

    • Indole-3-propionic acid (IPA) treatment prevents β-amyloid aggregation and ER stress in GPR37-overexpressing PD models

    • Dextromethorphan co-administration with buprenorphine inhibits GPR37 aggregation and mitigates proapoptotic ER stress responses

    • Targeted activation of GPR37 signaling with specific agonists enhances neuronal survival

  • Biomarker development: N-terminus-cleaved domain of GPR37 (ecto-GPR37) shows increased levels in CSF of PD patients but not Alzheimer's patients, suggesting a specific association with PD pathology. For detection:

    • Develop ELISA or nanoluciferase-based immunoassays targeting specific epitopes

    • Establish cutoff values based on ROC curve analysis (typical sensitivity/specificity: 75-85%)

    • Correlate with disease progression markers

  • Genetic approaches: Loss-of-function mutations in GPR37 are associated with early-onset autosomal recessive juvenile PD. Consider screening for these mutations in appropriate populations using next-generation sequencing approaches .

How does GPR37 contribute to myelination and demyelinating disorders?

GPR37 plays a critical role in oligodendrocyte differentiation, myelination, and remyelination after injury, with significant implications for demyelinating disorders. Research approaches to investigate these functions include:

  • Developmental studies:

    • Analyze GPR37 expression patterns during oligodendrocyte differentiation using qPCR and immunocytochemistry

    • Compare myelination in GPR37-knockout versus wild-type animals using electron microscopy and myelin-specific staining

    • Measure g-ratio (axon diameter/fiber diameter) as a quantitative indicator of myelination (typically 0.6-0.7 in healthy white matter)

  • Demyelination models:

    • Cuprizone model (0.2% cuprizone diet for 4-6 weeks) to induce demyelination

    • Lysolecithin injection for focal demyelination

    • MOG-induced EAE for immune-mediated demyelination

    • Compare remyelination efficiency between wild-type and GPR37-deficient animals

  • Molecular mechanisms:

    • OCN activates GPR37 with an EC50 of 10.2 nM to regulate oligodendrocyte differentiation and myelination

    • GPR37 signaling promotes oligodendrocyte differentiation through ERK pathway activation

    • Upon demyelinating injury, GPR37 expression is upregulated in oligodendrocyte precursor cells

  • Therapeutic implications:

    • Test OCN or synthetic GPR37 agonists in demyelination models to promote remyelination

    • Evaluate combination therapies targeting GPR37 and other promyelinating pathways

    • Develop cell-specific delivery systems to target GPR37 modulators to oligodendrocyte lineage cells

A significant finding is that GPR37-deficient mice show delayed remyelination after injury, with approximately 40-50% reduction in myelin basic protein expression compared to wild-type controls at 14 days post-injury .

How do protein-protein interactions modulate GPR37 function and trafficking?

GPR37 engages in multiple protein-protein interactions that significantly impact its trafficking, signaling, and degradation. To study these interactions, implement the following methodological approaches:

  • PDZ domain interactions: GPR37 interacts with multiple PDZ domain-containing proteins through its C-terminal PDZ-binding motif.

    • Perform co-immunoprecipitation with epitope-tagged GPR37 and candidate PDZ proteins

    • Use yeast two-hybrid screening with the C-terminal domain as bait

    • Confirm interactions using proximity ligation assays (PLA) in native tissues

  • MUPP1-CASPR2-GPR37 complex: This complex plays a crucial role in dendritic organization relevant to autism spectrum disorders.

    • Employ FRET/BRET to measure protein proximity in living cells

    • Generate mutants lacking the PDZ-binding motif to disrupt specific interactions

    • Analyze ASD-related GPR37 mutations for altered protein binding profiles

  • Parkin interaction: The E3 ubiquitin ligase Parkin interacts with GPR37 and promotes its degradation.

    • Compare GPR37 levels in Parkin-deficient versus wild-type cells

    • Analyze ubiquitination patterns of GPR37 using ubiquitin pulldown assays

    • Test if Parkin mutations associated with PD affect GPR37 degradation

  • Functional consequences of interactions:

    • Measure receptor internalization rates using surface biotinylation

    • Assess signaling differences when specific interactions are disrupted

    • Analyze subcellular localization changes using confocal microscopy

  • Therapeutic targeting of interactions:

    • Develop peptide mimetics that compete for specific binding interfaces

    • Screen for small molecules that stabilize beneficial interactions

    • Design protein interface modulators using structure-based approaches

The autism-related mutation of GPR37 disrupts the CASPR2-MUPP1-GPR37 complex on dendrites, potentially contributing to ASD pathogenesis through altered synaptic organization and function .

What are the most promising homology modeling approaches for rat GPR37 structure prediction?

Homology modeling of GPR37 presents unique challenges due to its orphan status and limited structural data. For researchers pursuing structural characterization, implement this methodological framework:

  • Template selection strategy:

    • Choose multiple templates with sequence similarity >25% focusing on the transmembrane regions

    • Prioritize templates with known ligand complexes to improve binding site modeling

    • Consider both active and inactive GPCR structures to model different conformational states

  • Alignment optimization:

    • Manually curate alignments in transmembrane regions using conserved GPCR motifs as anchors

    • Employ specialized GPCR-specific alignment tools like GPCRM or GOMoDo

    • Validate alignments through evolutionary conservation analysis

  • Model refinement approaches:

    • Implement molecular dynamics simulations (100-500 ns) in lipid bilayer environments

    • Apply enhanced sampling techniques like metadynamics to explore conformational space

    • Refine loops and N-terminal domain using ab initio methods

  • Model validation:

    • Calculate DOPE scores, TM scores, and RMSD values to assess model quality

    • Perform virtual screening with known pharmacological modulators to validate binding site

    • Compare predicted structural features with experimental data (mutagenesis, crosslinking)

  • Advanced techniques:

    • Integrate experimental constraints from crosslinking or mass spectrometry

    • Apply machine learning approaches like AlphaFold with GPCR-specific modifications

    • Generate ensemble models to represent receptor flexibility

The long N-terminal domain of GPR37 presents a particular challenge for modeling. Consider modeling this domain separately using template-free methods and then integrating it with the transmembrane domain model. For binding site prediction, utilize information from phylogenetically related receptors, focusing on conserved pockets within the transmembrane region .

How should researchers design studies investigating the role of GPR37 in cancer progression?

GPR37 has emerging roles in multiple cancer types, requiring systematic research approaches to elucidate its mechanisms and therapeutic potential:

  • Expression profiling methodology:

    • Analyze GPR37 expression across cancer types using publicly available datasets (TCGA, GEO)

    • Perform immunohistochemistry on tissue microarrays with proper controls

    • Correlate expression with clinical outcomes using Kaplan-Meier analysis

    • Compare expression in tumor vs. adjacent non-tumorous tissues

  • Cancer-specific studies based on current evidence:

Cancer TypeGPR37 ExpressionSignaling PathwayExperimental Approach
Lung AdenocarcinomaUpregulatedTGF-β1/SmadCRISPR knockout + migration/invasion assays
Hepatocellular CarcinomaDownregulatedPI3K-AktsiRNA knockdown + apoptosis assays
Multiple MyelomaVariedAKT/ERKCell adhesion assays + pathway inhibitors
GliomaUpregulatedp-AKT (Ser473)Cell cycle analysis + in vivo models
Gastric CancerCo-expressed with REG4Positive feedback loopPeritoneal metastasis models
  • Mechanistic investigations:

    • Gain/loss-of-function assays in appropriate cell lines

    • Analysis of downstream signaling using phosphoproteomic approaches

    • Investigation of GPR37-TGF-β1 pathway interactions

    • Characterization of GPR37's role in tumor-infiltrating immune cells

  • Therapeutic targeting strategies:

    • Develop GPR37 antagonists for cancers where it promotes progression

    • Create agonists for cancers where it suppresses growth

    • Explore combination approaches with established therapies

    • Test antibody-drug conjugates targeting GPR37 in overexpressing tumors

In glioma research, GPR37 upregulation correlates with increased proliferation, decreased G1/G0 phase cells, increased S and G2 phase cells, and enhanced phosphorylation of p-AKT (Ser473), suggesting it as a potential therapeutic target .

What are the common challenges in GPR37 research and how can they be addressed?

Researchers studying GPR37 frequently encounter specific technical challenges. Implement these methodological solutions:

  • Protein misfolding and aggregation:

    • Challenge: GPR37 tends to misfold when overexpressed in heterologous systems

    • Solution: Co-express with molecular chaperones (HSJ1b, Hsc70) and use lower expression levels (reduce DNA amount by 50-70%)

    • Validation: Perform biotinylation assays to confirm surface expression

  • Inconsistent pharmacological responses:

    • Challenge: Variable responses to potential ligands across different studies

    • Solution: Use primary cell cultures rather than recombinant systems for ligand validation

    • Approach: Test multiple readouts (cAMP, Ca²⁺, ERK) with positive controls in parallel

  • Antibody specificity issues:

    • Challenge: Non-specific binding in immunodetection methods

    • Solution: Validate antibodies using GPR37 knockout tissues/cells as negative controls

    • Approach: Target the C-terminal domain which remains intact after processing

  • Processing heterogeneity:

    • Challenge: Multiple receptor forms due to proteolytic processing

    • Solution: Use C-terminal tags for full-length tracking; include ADAM-10 inhibitors (GI254023X, 5 μM) to prevent processing

    • Analysis: Distinguish between mature (glycosylated) and immature forms by EndoH/PNGase F treatment

  • Contradictory disease associations:

    • Challenge: Variable findings across different disease models

    • Solution: Standardize analysis methods, tissue collection protocols, and control matching

    • Approach: Consider tissue-specific effects and disease stage in interpretation

  • Functional redundancy with GPR37L1:

    • Challenge: Distinguishing specific roles of GPR37 vs. its paralog GPR37L1

    • Solution: Use paralog-specific knockdown/knockout models and selective ligands

    • Validation: Confirm selectivity of effects using rescue experiments with each receptor

For GPR37 signaling studies, observed maximum inhibition of forskolin-stimulated cAMP typically ranges from 40-60% with a 5-10 nM EC50 for known modulators. Deviations from these ranges may indicate technical issues requiring optimization .

How can researchers distinguish between physiological roles of GPR37 and its paralog GPR37L1?

GPR37 and GPR37L1 share significant sequence homology (approximately 48% identity), creating challenges in distinguishing their unique physiological functions. Implement this methodological framework:

  • Expression analysis differentiation:

    • Perform high-resolution in situ hybridization with paralog-specific probes

    • Use single-cell RNA sequencing to map cell type-specific expression

    • Develop selective antibodies targeting unique epitopes in each paralog

    • Compare temporal expression patterns during development

  • Selective genetic approaches:

    • Generate single and double knockout models to identify unique vs. redundant phenotypes

    • Use conditional knockout strategies to target specific cell populations

    • Employ CRISPR interference for acute, cell-type-specific knockdown

    • Validate knockout/knockdown efficiency with paralog-specific qPCR

  • Pharmacological discrimination:

    • Test candidate ligands (OCN, HA peptide) for paralog selectivity

    • Develop paralog-selective synthetic ligands based on structure models

    • Use signaling fingerprints to distinguish receptor-specific responses

    • Perform competitive binding assays with potential shared ligands

  • Signaling pathway analysis:

    • Compare G-protein coupling preferences using BRET-based assays

    • Analyze β-arrestin recruitment profiles and internalization kinetics

    • Map downstream signaling networks using phosphoproteomics

    • Identify paralog-specific protein interaction partners

  • Disease relevance discrimination:

    • Compare paralog expression changes in disease models

    • Correlate clinical outcomes with paralog-specific markers

    • Assess therapeutic responses to paralog-selective modulators

Key experimental findings demonstrate that while GPR37 is primarily expressed in oligodendrocytes and associated with myelination, GPR37L1 shows broader expression in astrocytes and relates to cerebellar development. GPR37 knockout mice display impaired remyelination after injury, while GPR37L1 knockout mice exhibit increased susceptibility to seizures, suggesting distinct physiological roles despite structural similarity .

What are the best practices for designing and interpreting GPR37 knockout studies?

GPR37 knockout studies require careful design and interpretation to yield meaningful insights. Follow these methodological guidelines:

  • Knockout strategy selection:

    • Global knockout: Suitable for initial phenotypic characterization

    • Conditional knockout: Preferred for cell-type specific and developmental studies

    • Inducible knockout: Optimal for temporal control to distinguish developmental vs. adult roles

    • CRISPR-mediated knockout: Effective for rapid screening in cell models

  • Validation requirements:

    • Confirm knockout at DNA level (genotyping PCR, sequencing)

    • Verify absence of protein expression (Western blot, immunohistochemistry)

    • Check for compensatory changes in related proteins (especially GPR37L1)

    • Screen for off-target effects in CRISPR-based approaches

  • Comprehensive phenotyping approach:

    • Baseline characterization: Growth, development, general health assessment

    • CNS-focused analysis: Motor function, cognition, myelination status

    • Disease-relevant phenotyping: PD models, demyelination challenges, inflammatory stimuli

    • Molecular phenotyping: Transcriptomics, proteomics of affected tissues

  • Control considerations:

    • Use littermate controls whenever possible

    • Include heterozygous animals to assess gene dosage effects

    • Consider background strain effects (C57BL/6 vs. 129Sv backgrounds show different phenotypic outcomes)

    • Age-match subjects carefully, especially for neurodegeneration studies

  • Rescue experiments:

    • Re-express wild-type or mutant GPR37 to confirm phenotype specificity

    • Use pharmacological rescue with selective ligands

    • Employ downstream pathway activators to bypass receptor function

  • Data interpretation guidelines:

    • Distinguish direct vs. indirect effects through temporal analysis

    • Consider compensatory mechanisms that may mask phenotypes

    • Integrate findings with human genetic and clinical data

    • Compare with other models (siRNA knockdown, dominant negative approaches)

In GPR37 knockout mice, researchers typically observe a 30-40% reduction in myelin basic protein and PLP expression in the corpus callosum, along with a 20-25% decrease in the g-ratio of myelinated axons, indicating thinner myelin sheaths. These changes correlate with subtle motor coordination deficits in rotarod performance tests (typically 15-20% reduction in latency to fall) .

What are the most promising therapeutic applications for GPR37 modulation?

Based on current understanding of GPR37 biology, several therapeutic applications show particular promise for future development:

  • Parkinson's disease interventions:

    • Chaperone-based therapies to prevent GPR37 misfolding and aggregation

    • Small molecule stabilizers to reduce ER stress and protect dopaminergic neurons

    • CSF ecto-GPR37 as a biomarker for patient stratification and progression monitoring

    • Combination approaches targeting both GPR37 and α-synuclein aggregation

  • Demyelinating disorders:

    • GPR37 agonists to promote remyelination in multiple sclerosis

    • OCN or synthetic mimetics to enhance oligodendrocyte differentiation

    • Cell-based therapies with GPR37-overexpressing oligodendrocyte precursors

    • Combinatorial approaches with other promyelinating factors

  • Neuroinflammatory conditions:

    • GPR37 activation in macrophages/microglia to modulate inflammatory responses

    • OCN/GPR37 pathway targeting to regulate phagocytic function

    • Anti-inflammatory strategies based on GPR37-mediated protection against LPS-induced inflammation

  • Cancer therapeutics:

    • Context-dependent approaches based on tumor-specific GPR37 expression patterns

    • Antagonists for cancers where GPR37 promotes progression (lung adenocarcinoma, glioma)

    • Agonists for cancers where GPR37 suppresses growth (hepatocellular carcinoma)

    • GPR37-targeted antibody-drug conjugates for tumors with high receptor expression

  • Autism spectrum disorders:

    • Modulators targeting the CASPR2-MUPP1-GPR37 complex to normalize synaptic function

    • Genetic screening for GPR37 variants in ASD cohorts

    • Development of compounds that stabilize beneficial protein-protein interactions

For most promising near-term applications, researchers should prioritize: (1) validation of ecto-GPR37 as a PD biomarker in larger cohorts, (2) development of selective GPR37 agonists for remyelination, and (3) exploration of GPR37 chaperones for neuroprotection .

What advanced technologies will drive future GPR37 research breakthroughs?

Emerging technologies are poised to accelerate GPR37 research in several key areas:

  • Structural biology advances:

    • Cryo-EM applied to GPR37 structure determination in various conformational states

    • Integration of AlphaFold-based predictions with experimental constraints

    • Single-particle tracking of GPR37 dynamics in native membranes

    • Novel protein engineering approaches to stabilize GPR37 for crystallization

  • High-throughput screening technologies:

    • DNA-encoded libraries for ligand discovery (>10^10 compounds)

    • AI-driven virtual screening based on pharmacophore modeling

    • Cell-based phenotypic screens in disease-relevant models

    • Fragment-based drug discovery approaches targeting GPR37

  • Advanced genetic tools:

    • CRISPR-based epigenetic modulators for refined control of GPR37 expression

    • Base editing to introduce disease-relevant mutations in model systems

    • Single-cell multiomics to capture receptor function in heterogeneous tissues

    • Spatial transcriptomics to map GPR37 expression in complex tissues

  • Imaging innovations:

    • Advanced GPCR biosensors to visualize GPR37 activation in real time

    • Expansion microscopy for nanoscale visualization of GPR37 localization

    • Multiplexed ion beam imaging to correlate GPR37 with multiple markers

    • In vivo optogenetics using ChR2/opto-GPR37 for precise temporal control

  • Translational research tools:

    • Human iPSC-derived brain organoids expressing GPR37 variants

    • Microfluidic organs-on-chips to model GPR37 function in multicellular contexts

    • Improved biomarker detection platforms for ecto-GPR37 quantification

    • Machine learning algorithms to identify GPR37-associated disease signatures

The integration of optogenetic approaches with GPR37 (ChR2/opto-GPR37) represents a particularly promising direction, enabling selective activation of GPR37 signaling in specific cells and analysis of behavioral responses in freely moving animals. This approach has already confirmed GPR37's Gαi/o signaling through reduction of cAMP levels, enhanced ERK phosphorylation, and increased motor activity .

What critical knowledge gaps need to be addressed in GPR37 research?

Despite significant advances in GPR37 research, several critical knowledge gaps remain that warrant focused investigation:

  • Endogenous ligand identification:

    • While OCN and HA peptide show activity, their status as true endogenous ligands remains uncertain

    • Comprehensive deorphanization efforts using tissue extracts and mass spectrometry

    • Investigation of potential autocrine/paracrine signaling loops

    • Determination of ligand release mechanisms and regulation

  • Signaling pathway characterization:

    • Detailed mapping of G protein coupling preferences beyond Gαi/o

    • Elucidation of β-arrestin recruitment patterns and biased signaling

    • Identification of pathway-specific phosphorylation patterns

    • Clarification of transcriptional programs regulated by GPR37 activation

  • Pathophysiological mechanisms:

    • Precise role in protein misfolding and aggregation in neurodegeneration

    • Contribution to oligodendrocyte differentiation and survival

    • Function in neuroinflammatory processes and microglial activation

    • Mechanisms underlying cancer progression or suppression

  • Receptor processing regulation:

    • Factors controlling ADAM-10-mediated proteolytic processing

    • Functional significance of different processed receptor forms

    • Role of ecto-GPR37 beyond serving as a biomarker

    • Disease-specific alterations in processing machinery

  • Structure-function relationships:

    • High-resolution structural data in active and inactive conformations

    • Identification of ligand binding pockets and allosteric sites

    • Structural basis for protein-protein interactions

    • Conformational changes associated with receptor activation

  • Therapeutic targeting opportunities:

    • Development of selective and potent pharmacological tools

    • Identification of druggable allosteric sites

    • Exploration of biased ligands to selectively activate beneficial pathways

    • Strategies to modulate GPR37 processing or stability rather than signaling

Addressing these knowledge gaps requires interdisciplinary approaches combining molecular pharmacology, structural biology, cell biology, and translational research. The most urgent priority is validating and identifying true endogenous ligands, as this will enable more focused investigations into physiological functions and therapeutic applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.