Recombinant Rat Probable G-protein coupled receptor 88 (Gpr88)

Shipped with Ice Packs
In Stock

Description

Expression Patterns & Cellular Localization

  • Developmental Timeline: Detectable in rat striatal primordium by embryonic day 16 (E16), with peak expression in adulthood .

  • Brain Regions:

    • High density: Striatum, nucleus accumbens, olfactory tubercle, amygdala .

    • Cortical redistribution: Shifts from plasma membrane in prenatal stages to nuclear localization in postnatal layers II-V .

  • Peripheral Tissues: Transient expression during development .

Functional Roles in Behavior & Disease

Knockout Mouse Phenotypes :

Behavior/ConditionGPR88⁻/− Phenotype
Motor coordinationImpaired rotarod performance
Anxiety-like behaviorReduced marble burying, elevated open-arm time
Spatial learningEnhanced Y-maze and cross-maze performance
Striatal dopamineIncreased D1/D2 receptor coupling

Neurological Implications:

  • Modulates GABAergic/glutamatergic signaling and interacts with opioid/dopamine receptors .

  • Regulates emotional processing, motor control, and addiction pathways .

Pharmacological Targeting

Agonists & Mechanisms:

  • RTI-13951-33:

    • EC₅₀ = 25 nM (cAMP assay) .

    • Reduces alcohol intake in C57BL/6 mice (30–60% reduction at 10–30 mg/kg) .

  • (1R,2R)-2-PCCA: Binds allosteric pocket involving TM5/6 and Gαi1 subunit, enhancing Gi coupling .

Therapeutic Potential:

  • Alcohol Use Disorder: RTI-13951-33 normalizes striatal GPR88 activity without affecting water intake .

  • Parkinson’s Disease & Schizophrenia: Linked to dopaminergic dysregulation and cognitive deficits .

Research Tools & Assays

Key Reagents:

  • Catalog Cr1141-1: Recombinant rat GPR88 cell line (Multispan), validated in TR-FRET cAMP assays .

  • Antibodies & Protein: Available through AliCE® (AA 1-384, Strep Tag) for ELISA/Western blot .

Assay Systems:

  • Functional cAMP Assays: Measure forskolin-stimulated inhibition (EC₅₀ = 25–100 nM) .

  • Behavioral Models: Rotarod, elevated plus maze, and alcohol two-bottle choice paradigms .

Challenges & Future Directions

  • Endogenous Ligand: Unidentified; orphan status limits mechanistic studies .

  • Species-Specific Effects: Nuclear localization observed in primates/humans but not rodents .

  • Drug Development: Need for brain-penetrant agonists with improved pharmacokinetics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Gpr88; Strg; Probable G-protein coupled receptor 88; Striatum-specific G-protein coupled receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MTNSSSTSTSTTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFR KLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPAGSAEPPGDWDSGGGSYRLLRGGLL GLGLTVSLLSHCLVALNRYLLITRAPATYQVLYQRRHTAGMLALSWALALGLVLLLPPWA PKPGAEPPQVHYPALLAAGALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGC AAAAAAFPAAPHAPGAGGAAHPAQPQPLPAALQPRRAQRRLSGLSVLLLCCVFLLATQPL VWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAA AAAATAVPAMSQAQLGTRAAGQHW
Uniprot No.

Target Background

Function
Probable G-protein coupled receptor implicated in a wide range of behavioral responses involving motor activities, spatial learning, and emotional processing. It may play a crucial role in regulating cognitive and motor function.
Gene References Into Functions
  1. Our research suggests that GPR88 and GPR124 receptors may be involved in the development or maintenance of high blood pressure. PMID: 28678544
  2. In the developing cortex, GPR88 shifts on the day of birth to the nuclei of neurons in layers V to II. PMID: 26918661
  3. Our findings indicate a role for Gpr88 in the regulation of cognitive and motor functions. This supports its relevance to the pathophysiology and treatment of schizophrenia and other disorders involving dysfunction of the accumbens-striatal complex PMID: 25155879
  4. GPR88 is confined to striatal medium spiny neurons. This suggests that L-DOPA-mediated behavioral effects in hemiparkinsonian rats may involve normalization of striatal GPR88 levels PMID: 19656174
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm. Nucleus.
Tissue Specificity
Expressed predominantly in the striatum. Expressed also in olfactory tubercle, nucleus accumbens, amygdala, and neocortex. Spinal cord, pons, and medulla expression remains discrete. Also expressed in peripheral tissues, including adrenal cortex (E16-E21)

Q&A

What is GPR88 and what are its primary expression patterns?

GPR88 is an orphan G protein-coupled receptor (GPCR) consisting of 384 amino acids that forms a multi-pass membrane protein localizing to the cell membrane. It is expressed predominantly in the striatum, particularly in medium spiny neurons (MSNs) . Within the striatum, GPR88 shows high expression in both dopamine D1 receptor-expressing and D2 receptor-expressing MSNs .

How is GPR88 conserved across species?

Human GPR88 shares 95% sequence identity with its rat counterpart, indicating strong evolutionary conservation of this receptor . This high degree of sequence homology suggests that GPR88 likely performs critical and conserved functions across mammalian species. The strong conservation makes rat models particularly valuable for investigating GPR88 functions relevant to human physiology and pathology.

What experimental models are available for studying GPR88 function?

Several genetic models have been developed to study GPR88 function:

  • Total Gpr88 knockout mice (Gpr88-/-)

  • Conditional Gpr88 knockout using adenosine A2AR-Cre-driven recombination (A2AR-Gpr88 KO)

  • Cell-type specific knockout models

In Gpr88 knockout mice, medium spiny neurons display higher firing rates and increased sensitivity to cortical stimulation compared to wild-type controls . These models have revealed that GPR88 deletion leads to:

  • Increased locomotor activity

  • Hypersensitivity to novelty

  • Reduced anxiety-like behaviors

  • Impairments in rotarod performance and active-avoidance tasks

Conditional knockout models (like the A2AR-Gpr88 KO) have allowed researchers to study the contribution of GPR88 in specific neuronal populations, revealing distinct functions of GPR88 in different cell types .

How does GPR88 modulate signaling of other GPCRs?

GPR88 functions as a modulator of other GPCR signaling pathways. Studies have revealed that GPR88 can:

  • Inhibit the activation of both G protein- and β-arrestin-dependent signaling pathways of opioid receptors

  • Decrease G protein-dependent signaling of most receptors in close proximity

  • Impede β-arrestin recruitment by all tested receptors

This buffering role appears to be selective, as GPR88 shows physical proximity with certain receptors but not others. Evidence indicates that GPR88 can form heteromeric complexes with:

  • Muscarinic M1 and M4 receptors

  • Dopamine D2 receptors

  • Adenosine A2A receptors

  • GPR12 receptors

Interestingly, no proximity was detected between GPR88 and dopamine D1 receptors, vasopressin V2 receptors, or chemokine CXCR4 receptors, suggesting selective interaction partners .

What methods are recommended for studying GPR88 interactions with other receptors?

Based on published research, the following methodological approaches are recommended:

  • Proximity-based assays: BRET (Bioluminescence Resonance Energy Transfer) or FRET (Fluorescence Resonance Energy Transfer) to detect physical proximity between GPR88 and other GPCRs

  • Functional assays: G protein activation measurements (cAMP, calcium, MAPK) and β-arrestin recruitment assays in cells co-expressing GPR88 and partner receptors

  • Co-immunoprecipitation: To confirm physical interactions between GPR88 and other receptors

When conducting these experiments, researchers should:

  • Include appropriate positive and negative controls

  • Use both overexpression systems and native tissues

  • Compare signaling in wild-type versus Gpr88 knockout backgrounds

How does GPR88 regulate anxiety-related behaviors?

GPR88 plays a critical role in modulating anxiety-like behaviors, with distinct effects depending on the neuronal population expressing the receptor. Studies comparing total Gpr88 knockout mice with conditional A2AR-Gpr88 knockout mice have revealed:

Behavioral TestTotal Gpr88 KOA2AR-Gpr88 KO
Light/Dark TestDecreased anxietyDecreased anxiety
Elevated Plus MazeDecreased anxietyDecreased anxiety
Novelty PreferenceIncreasedNo change
Novelty-Suppressed FeedingDecreasedNo change
Fear ConditioningDecreasedNo change

These findings demonstrate that GPR88 expression in A2AR neurons (predominantly D2R-expressing MSNs) specifically enhances ethological anxiety-like behaviors without affecting conflict anxiety and fear responses . The anxiogenic activity of GPR88 therefore operates primarily at the level of A2AR-expressing neurons, while other GPR88-expressing neuronal populations likely mediate effects on approach behaviors and conditional fear .

What role does GPR88 play in opioid response and addiction-related behaviors?

GPR88 exerts a tonic inhibitory action on μ-opioid receptor (μOR) signaling. In Gpr88 knockout mice:

  • Morphine-induced locomotor sensitization is facilitated

  • Morphine withdrawal symptoms are enhanced

  • Supra-spinal analgesia is facilitated, as evidenced by increased jumping latency in the hot-plate test

  • Spinal analgesia (tail immersion test) is blunted

  • Extinction of morphine-induced conditioned place preference occurs more rapidly than in wild-type mice

These findings indicate that GPR88 normally constrains certain morphine-induced responses. Interestingly, while GPR88 deletion affects morphine responses, it does not alter morphine reward as measured by conditioned place preference acquisition and reinstatement .

How does GPR88 contribute to foraging efficiency and energy homeostasis?

GPR88 expression is necessary for efficient integration of effort and energy density information that guides instrumental choice during foraging . In wild-type animals, evolutionary pressure has favored neural systems that optimize energy efficiency by:

  • Detecting and comparing caloric value

  • Biasing foraging toward maximum energy efficiency

  • Guiding behavior toward superior nutritional density or minimized caloric expenditure

The striatum, where GPR88 is highly expressed, is anatomically and functionally positioned to perform the sensory and motor integration necessary for efficient action selection during foraging. GPR88 knockout mice show impaired ability to efficiently integrate effort and energy density information, suggesting that this receptor plays a critical role in these evolutionary conserved mechanisms .

What neuropsychiatric disorders have been linked to GPR88 dysfunction?

Gene association studies in humans have revealed links between GPR88 function and several disorders:

  • Schizophrenia

  • Bipolar disorder

  • Speech delay

  • Chorea

The striatal enrichment of GPR88 and its role in modulating dopamine receptor signaling make it particularly relevant to disorders involving striatal dysfunction. The loss of GPR88's protective buffering role may contribute to neuropsychiatric conditions, as it normally dampens GPCR activity in striatal and amygdala neuronal populations .

What is the potential of GPR88 as a therapeutic target?

GPR88 is considered a promising therapeutic target for neuropsychiatric disorders for several reasons:

  • Its selective expression pattern, predominantly in the striatum

  • Its ability to modulate multiple GPCR signaling pathways

  • Its involvement in anxiety-related behaviors, addiction processes, and motor functions

Potential therapeutic applications include:

  • Anxiety disorders: GPR88 antagonists might reduce anxiety-like behaviors based on knockout studies

  • Addiction: Modulating GPR88 might affect drug sensitization and withdrawal

  • Movement disorders: GPR88 modulation could potentially address disorders involving striatal dysfunction

The buffering role of GPR88 on striatal GPCR signaling suggests that pharmaceuticals targeting this receptor might help normalize dysregulated signaling in neuropsychiatric conditions .

What methodologies are recommended for recombinant GPR88 expression and purification?

For researchers working with recombinant rat GPR88:

  • Expression systems:

    • HEK293 cells for mammalian expression

    • Sf9 insect cells for higher yield

    • Stable cell lines expressing GPR88 with epitope tags (HA, FLAG, or His)

  • Purification approaches:

    • Immunoaffinity chromatography using antibodies against epitope tags

    • Protein A purification for antibody preparation

    • Inclusion of detergents to maintain membrane protein stability

  • Storage conditions:

    • Store at -20°C in buffer containing glycerol (50%)

    • Avoid repeated freeze/thaw cycles

What are the consequences of cell-type specific deletion of GPR88?

Conditional knockout studies have revealed distinct roles of GPR88 in different neuronal populations:

  • In A2AR-expressing neurons (predominantly D2R-MSNs):

    • Mediates anxiogenic effects in ethological anxiety tests

    • Contributes to locomotor regulation

    • Does not affect novelty preference, novelty-suppressed feeding, or fear conditioning

  • In other neuronal populations:

    • Regulates approach behaviors and conditional fear

    • May contribute to reward processing and addiction-related behaviors

These findings highlight the importance of cell-type specific approaches when studying GPR88 function, as this receptor appears to play distinct roles depending on its cellular context .

How can researchers effectively detect and quantify GPR88 expression?

For detection and quantification of GPR88, researchers should consider:

  • Antibody-based methods:

    • Western blotting (WB) with polyclonal antibodies

    • Immunohistochemistry (IHC-P, IHC-F)

    • Immunofluorescence (IF)

    • Immunocytochemistry (ICC)

  • RNA-based methods:

    • qPCR for mRNA quantification

    • In situ hybridization for spatial localization

  • Recommended applications and dilutions:

ApplicationRecommended Dilution
WB1:300-5000
ELISA1:500-1000
IHC-P1:200-400
IHC-F1:100-500
IF(IHC-P)1:50-200
IF(IHC-F)1:50-200
IF(ICC)1:50-200
ICC1:100-500

These methodologies provide complementary approaches to study GPR88 expression at both protein and mRNA levels .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.