Recombinant Rat Probable lipid phosphate phosphatase PPAPDC3 (Ppapdc3)

Shipped with Ice Packs
In Stock

Description

Introduction to PPAPDC3

PPAPDC3 (phosphatidic acid phosphatase type 2 domain-containing protein 3), also known as PLPP7 or NET39, is a nuclear envelope transmembrane protein belonging to the PAP2 superfamily of lipid phosphatases. Despite structural homology to active phosphatases, PPAPDC3 lacks enzymatic activity and functions primarily as a regulatory protein in muscle biology . The recombinant rat variant (Ppapdc3) is a truncated or full-length protein expressed in heterologous systems for research purposes, enabling studies on its role in myoblast differentiation, nuclear envelope organization, and muscle function .

Gene and Protein Information

ParameterDetails
Gene NamePpapdc3 (Rat) / PPAPDC3 (Human)
Alternative NamesPLPP7, NET39, C9orf67, RGD1305821 (Rat)
ChromosomeChromosome 9 (human ortholog)
Protein Length271 amino acids (Rat partial recombinant) / Full-length sequence varies
Molecular Weight~30 kDa (estimated for partial recombinant)

Expression and Purity

Recombinant rat Ppapdc3 is typically expressed via cell-free synthesis or in E. coli, yeast, or mammalian cells, with purity ≥85% as confirmed by SDS-PAGE . Key regions include residues 1–271, which span critical domains for nuclear envelope localization and protein interactions .

Sequence and Domain Features

The recombinant protein retains conserved motifs:

  • Lipid phosphatase homology domains (C1, C2, C3), though enzymatically inactive .

  • Transmembrane helices orienting catalytic domains toward the cytoplasmic face .

  • Nuclear envelope localization signals for interaction with chromatin and mTOR .

Functional Role in Muscle Biology

PPAPDC3 regulates myoblast differentiation and nuclear envelope organization through non-catalytic mechanisms:

Key Mechanisms

  1. Negative Regulation of Myogenesis

    • mTOR Inhibition: PPAPDC3 binds and diminishes mTOR activity, reducing insulin-like growth factor II (IGF-II) signaling and autocrine growth factor production, thereby repressing differentiation .

    • Gene Repositioning: Inhibits differentiation by repressing pro-myogenic genes via chromatin reorganization at the nuclear periphery .

  2. Nuclear Envelope Integrity

    • Maintains chromatin organization and gene expression critical for muscle function .

    • Disruption linked to Emery-Dreifuss muscular dystrophy (EDMD3) and muscle pathology .

Recombinant Protein Uses

ApplicationDetails
Western Blot (WB)Detects Ppapdc3 expression in muscle lysates; validated with rabbit polyclonal antibodies .
ELISAQuantifies Ppapdc3 levels in rat tissues or cell lysates using recombinant standards .
RNA Interference (RNAi)siRNA knockdown studies to assess differentiation and mTOR signaling .

Antibody and Control Fragment Tools

  • Antibodies: Rabbit polyclonal IgG antibodies specific to Ppapdc3 (e.g., ABIN605141, ABIN6991238) for WB, IHC, and IF .

  • Control Fragments: Recombinant human PPAPDC3 (aa 170–202) for blocking experiments in IHC/WB .

Exercise and Ppapdc3 Expression

  • Downregulation: Ppapdc3 expression decreases with acute maximal exercise and voluntary wheel running, suggesting a role in exercise-induced muscle adaptation .

  • Muscle-Specific Regulation: Enriched in fast-twitch muscles and linked to nuclear envelope structure .

Functional Studies

StudyFindings
Knockdown in MyoblastsAccelerated differentiation via mTOR activation and IGF-II signaling .
OverexpressionRepressed myogenesis and altered nuclear envelope morphology .
Nuclear LocalizationInteracts with chromatin to repress pro-differentiation genes .

Table 1: Recombinant Rat Ppapdc3 Products

SourceFormHost SystemPurityApplications
MyBioSourcePartial proteinCell-free≥85%WB, ELISA, IHC
Colorectal ResearchFull-lengthE. coli/Yeast≥85%ELISA, WB, IHC
Thermo FisherControl fragmentMammalianNot statedBlocking in WB/IHC

Table 2: Critical Research Studies

StudyModel SystemKey FindingReference
NET39 and mTORC2C12 myoblastsNET39 inhibits differentiation via mTOR
Nuclear Envelope RoleMouse skeletal muscleNET39 maintains chromatin organization
Exercise ResponseRat voluntary runningPpapdc3 downregulated post-exercise

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: Our standard shipping method includes normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Plpp7; Ppapdc3; Inactive phospholipid phosphatase 7; Phosphatidic acid phosphatase type 2 domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Plpp7
Target Protein Sequence
MPVSQSRARARDRNNVLNRAEFLSLNQPPKGTQEPRSSGRKASGPSTQPPPSSDGARERR QSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITS HGIPWIGGTILCLVRSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPGLLD YLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWAFCVGLSRVMIGRHHITDV ISGFIIGYFQFRLVELVWMSSNTCQMLISAW
Uniprot No.

Target Background

Function
PPAPDC3 (Ppapdc3), a probable lipid phosphate phosphatase, acts as a negative regulator of myoblast differentiation. It exerts its effect, at least in part, through modulation of the MTOR signaling pathway. No detectable enzymatic activity has been observed for PPAPDC3.
Database Links

KEGG: rno:296635

UniGene: Rn.24087

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Nucleus envelope. Endoplasmic reticulum membrane. Membrane; Multi-pass membrane protein.

Q&A

What is PPAPDC3 and what is its function in muscle tissue?

PPAPDC3 is a phosphatidic acid phosphatase type 2 domain-containing protein that functions as a negative regulator of myoblast differentiation. It is highly expressed in cardiac and skeletal muscle and becomes strongly upregulated during cultured myoblast differentiation. Research has demonstrated that overexpression of PPAPDC3 in myoblasts represses myogenesis, while knockdown by RNA interference promotes differentiation, indicating its significant role in the regulatory mechanism for muscle development .

What techniques are recommended for studying PPAPDC3 expression patterns?

For studying PPAPDC3 expression patterns, researchers should employ multiple complementary approaches:

  • Western blotting with validated antibodies specific to PPAPDC3

  • Immunohistochemistry (IHC) and immunocytochemistry (ICC) for spatial expression analysis

  • Quantitative PCR (qPCR) for mRNA expression quantification

  • Antibody validation experiments using recombinant protein fragments

When working with recombinant PPAPDC3 protein fragments, they can be used in blocking experiments with corresponding antibodies, typically using a 100x molar excess of the protein fragment based on concentration and molecular weight, pre-incubated with the antibody for 30 minutes at room temperature .

How conserved is PPAPDC3 across species?

PPAPDC3 shows high conservation across mammalian species, with human PPAPDC3 (aa 170-202) fragment sharing 97% sequence identity with both mouse and rat orthologs . This high degree of conservation suggests evolutionary importance and supports the use of rodent models for studying functions relevant to human biology.

SpeciesSequence Identity to Human PPAPDC3 (aa 170-202)
Mouse97%
Rat97%
Human100%

How should researchers design experiments to investigate PPAPDC3's role in myoblast differentiation?

To investigate PPAPDC3's role in myoblast differentiation, researchers should implement a multi-faceted approach:

  • Establish in vitro myoblast cell cultures (C2C12 cells) and manipulate PPAPDC3 expression using:

    • Overexpression vectors

    • siRNA/shRNA-mediated knockdown

  • Monitor differentiation through multiple readouts:

    • Myogenic markers (MyoD, myogenin, MHC) via Western blot and qPCR

    • Morphological changes via immunofluorescence staining

    • Fusion index quantification

  • Analyze mTOR pathway signaling:

    • Assess phosphorylation status of mTOR components (mTOR, S6K, 4E-BP1)

    • Use mTOR inhibitors (rapamycin) in combination with PPAPDC3 modulation

  • Conduct time-course experiments to determine when PPAPDC3 exerts its effects during differentiation

  • For in vivo relevance, develop and analyze muscle-specific knockout or overexpression mouse models

These approaches should be implemented with appropriate controls to isolate PPAPDC3-specific effects from general perturbations of cellular homeostasis .

What methodological considerations are important when purifying functional recombinant rat Ppapdc3?

Purifying functional recombinant rat Ppapdc3 presents several challenges due to its membrane-associated nature. Researchers should consider:

  • Expression systems:

    • Use eukaryotic systems (insect or mammalian cells) rather than bacterial systems

    • Consider fusion tags that enhance solubility (MBP, SUMO) in addition to affinity tags

  • Extraction and purification conditions:

    • Optimize detergent conditions—mild non-ionic detergents like DDM or CHAPS

    • Implement stepwise purification combining affinity chromatography with size exclusion

  • Validation approaches:

    • Confirm structural integrity through circular dichroism

    • Validate protein activity using phosphatase assays with appropriate substrates

    • Evaluate blocking efficiency in antibody validation experiments as described in product documentation

  • Storage considerations:

    • Determine optimal buffer conditions and temperature for maintaining activity

    • Assess freeze-thaw stability

How can researchers integrate PPAPDC3 research into comprehensive toxicological studies?

When incorporating PPAPDC3 research into toxicological studies, researchers should consider:

  • Adopt integrated experimental designs that maximize data collection while reducing animal usage:

    • Include PPAPDC3 analysis in multi-endpoint studies examining developmental, reproductive, and chronic toxicity

    • Follow established guidelines like OECD TG 443 and NTP protocols for standardization

  • Examine PPAPDC3 expression across different windows of susceptibility:

    • Prenatal, neonatal, prepubertal, pubertal, and adult stages

    • Both parous and nulliparous conditions

  • Collect tissues at multiple timepoints:

    • Interim sacrifices at 26, 52, 78, and 104 weeks

    • Store samples appropriately for multiple analysis methods

  • Implement proper controls:

    • Include vehicle controls

    • Consider positive controls with known effects on muscle development pathways

  • Analyze potential toxicant effects on mTOR signaling in relation to PPAPDC3 function

This integrated approach allows researchers to maximize information while adhering to the 3Rs (replacement, reduction, refinement) principles in animal research .

How should researchers interpret conflicting data between PPAPDC3 mRNA and protein expression?

When facing discrepancies between PPAPDC3 mRNA and protein expression levels, implement this systematic approach:

  • Validate assay reliability:

    • Confirm primer specificity for qPCR

    • Verify antibody specificity through blocking experiments with recombinant protein fragments

  • Consider regulatory mechanisms:

    • Post-transcriptional regulation (microRNAs, RNA-binding proteins)

    • Post-translational modifications affecting protein stability

    • Alterations in protein turnover rates

  • Perform additional experiments:

    • Conduct polysome profiling to assess translation efficiency

    • Implement pulse-chase experiments to determine protein half-life

    • Design time-course studies to reveal temporal dynamics

  • Address tissue heterogeneity:

    • Use cell-type specific markers in co-localization studies

    • Consider single-cell analysis approaches

  • Examine subcellular localization and extraction efficiency

Integration of these approaches can resolve apparent contradictions and potentially reveal novel regulatory mechanisms governing PPAPDC3 expression.

What controls are essential when analyzing PPAPDC3 levels in experimental samples?

When analyzing PPAPDC3 levels, researchers must include these essential controls:

  • Technical controls:

    • Positive control samples (cardiac and skeletal muscle tissues)

    • Loading controls for Western blots (GAPDH, β-actin)

    • Standard curves for quantitative methods

  • Experimental validation controls:

    • Genetic controls (PPAPDC3 knockout/knockdown samples)

    • Blocking experiment controls (pre-incubate antibodies with recombinant PPAPDC3 protein at 100x molar excess)

    • Isotype controls for immunostaining

  • Biological reference controls:

    • Temporal controls (developmental stages)

    • Tissue-specific expression patterns

    • Treatment-response controls

  • Assay-specific controls:

    • RT-qPCR (no-RT controls, reference gene validation)

    • Western blot (molecular weight markers, secondary-only controls)

    • IHC/ICC (absorption controls, peptide competition)

Proper implementation of these controls ensures reliable interpretation of experimental results and facilitates comparison across different studies.

What are common issues in PPAPDC3 antibody-based detection and how can they be resolved?

Common issues in PPAPDC3 antibody-based detection and their solutions include:

  • Issue: High background in Western blots
    Solution:

    • Optimize blocking conditions (try different blocking agents)

    • Increase washing duration and stringency

    • Titrate primary antibody concentration

    • Validate antibody specificity using recombinant protein blocking

  • Issue: Multiple bands in Western blots
    Solution:

    • Determine if bands represent isoforms, degradation products, or non-specific binding

    • Compare with PPAPDC3 knockout/knockdown samples

    • Pre-absorb antibody with recombinant protein fragment at 100x molar excess

    • Try different antibodies targeting different epitopes

  • Issue: Weak or absent signal in immunostaining
    Solution:

    • Optimize fixation and antigen retrieval methods

    • Increase antibody concentration or incubation time

    • Ensure tissue preservation of antigen

    • Verify expression in positive control tissues (cardiac/skeletal muscle)

  • Issue: Inconsistent results between experiments
    Solution:

    • Standardize protocols rigorously

    • Validate new antibody lots against previous ones

    • Document all experimental conditions comprehensively

    • Include both positive and negative controls in each experiment

How can researchers resolve contradictory findings regarding PPAPDC3's function across different experimental models?

To resolve contradictory findings across experimental models:

  • Standardize experimental conditions:

    • Use consistent cell densities and passage numbers

    • Apply identical differentiation protocols

    • Analyze at standardized timepoints

  • Conduct comparative analysis:

    • Perform side-by-side experiments with multiple model systems

    • Verify PPAPDC3 expression levels across models

    • Create isogenic cell lines with controlled PPAPDC3 expression

  • Implement comprehensive phenotyping:

    • Analyze multiple myogenic markers

    • Examine mTOR pathway activation across models

    • Design detailed time-course studies

  • Consider model-specific factors:

    • Genetic background differences

    • Compensatory mechanisms through transcriptomic analysis

    • Cell type heterogeneity in tissue samples

  • Translate findings systematically:

    • Develop comparable in vivo injury models

    • Use consistent analysis methods across systems

    • Document all variables that might contribute to discrepancies

This systematic approach helps identify whether contradictory findings reflect genuine biological differences or methodological variations.

How can CRISPR-Cas9 genome editing be optimized for studying PPAPDC3 function in muscle biology?

To optimize CRISPR-Cas9 editing for PPAPDC3 research in muscle biology:

  • Design considerations:

    • Create multiple sgRNAs targeting conserved functional domains

    • Design knock-in strategies for tagging endogenous PPAPDC3

    • Develop inducible CRISPR systems for temporal control

  • Delivery optimization for muscle cells:

    • Refine nucleofection protocols specifically for myoblasts

    • For in vivo editing, develop muscle-specific Cas9 expression using promoters like MCK

    • Consider AAV-based delivery systems for in vivo applications

  • Validation approaches:

    • Verify editing efficiency through sequencing and protein analysis

    • Assess potential compensatory upregulation of related phosphatases

    • Evaluate off-target effects comprehensively

  • Functional analysis strategies:

    • Combine editing with differentiation assays

    • Implement both acute and stable editing approaches

    • Analyze mTOR pathway signaling in edited cells

  • Advanced applications:

    • Create precise point mutations in catalytic domains

    • Generate reporter knock-ins to track endogenous expression

    • Combine with single-cell technologies for high-resolution phenotyping

What experimental approaches can reveal the molecular mechanism of PPAPDC3's inhibition of mTOR signaling?

To elucidate PPAPDC3's mechanism of mTOR inhibition:

  • Protein interaction studies:

    • Perform co-immunoprecipitation of PPAPDC3 with mTOR complex components

    • Use proximity labeling techniques (BioID, APEX) to identify the proximal interactome

    • Implement fluorescence resonance energy transfer (FRET) to assess direct interactions

  • Phosphatase activity analysis:

    • Conduct in vitro phosphatase assays with purified components

    • Identify relevant substrates through phosphoproteomic analysis

    • Use phosphatase-dead mutants as controls

  • Subcellular localization studies:

    • Perform co-localization analysis of PPAPDC3 with mTOR components

    • Examine dynamic relocalization during differentiation

    • Create domain deletion mutants to identify localization signals

  • Signaling pathway analysis:

    • Monitor phosphorylation status of key mTOR substrates (S6K, 4E-BP1)

    • Examine effects of PPAPDC3 modulation on both mTORC1 and mTORC2

    • Use pathway-specific inhibitors to dissect mechanisms

  • Lipid signaling investigation:

    • Analyze changes in phosphatidic acid levels with PPAPDC3 modulation

    • Investigate potential lipid intermediates affecting mTOR activity

    • Employ lipidomic approaches to identify relevant substrate pools

These approaches can provide mechanistic insights into how PPAPDC3's phosphatase activity affects the mTOR signaling pathway in muscle cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.