Recombinant Rat Probable N-acetyltransferase CML1 (Cml1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Probable N-acetyltransferase CML1 (Cml1)

Recombinant Rat Probable N-acetyltransferase CML1 (Cml1), also known as Camello-like protein 1, is an enzyme that functions as an N-acetyltransferase . N-acetyltransferases catalyze the transfer of acetyl groups from acetyl-CoA to arylamines and other substrates . Cml1 belongs to a family of enzymes involved in various biological processes, including detoxification and drug metabolism .

Gene and Protein Information

The gene name for Recombinant Rat Probable N-acetyltransferase CML1 (Cml1) is Cml1, with Cml2 as a synonym . The protein, with a full length of 221 amino acids, has the recommended name of Probable N-acetyltransferase CmL1, with the Enzyme Commission number EC= 2.3.1 . The Uniprot number for this protein is Q9QXT4 .

Production and Characteristics

Recombinant Rat Probable N-acetyltransferase CML1 (Cml1) is produced as a recombinant protein in a Tris-based buffer with 50% glycerol . It is recommended to store it at -20°C, with the possibility of conserving it at -20°C or -80°C for extended storage . Repeated freezing and thawing is not recommended . Working aliquots can be stored at 4°C for up to one week .

Function and Substrate Specificity

Recombinant rat Nat3 N-acetylated several arylamine substrates, including 3-ethylaniline, 3,5-dimethylaniline, 5-aminosalicylic acid, 4-aminobiphenyl, 4,4'-methylenedianiline, 4,4'-methylenebis(2-chloroaniline), and 2-aminofluorene, and the O-acetylation of N-hydroxy-4-aminobiphenyl . The relative affinities of arylamine carcinogens such as 4-aminobiphenyl, N-hydroxy-4-aminobiphenyl, and 2-aminofluorene for recombinant rat Nat3 were comparable to recombinant rat Nat1 and higher than for recombinant rat Nat2 .

SubstrateNat1 ActivityNat2 ActivityNat3 Activity
3-ethylanilineYesYesYes
3,5-dimethylanilineYesYesYes
5-aminosalicylic acidYesYesYes
4-aminobiphenylYesYesYes
4,4'-methylenedianilineYesYesYes
4,4'-methylenebis(2-chloroaniline)YesYesYes
2-aminofluoreneYesYesYes
N-hydroxy-4-aminobiphenylYesYesYes

Role in Disease and Biological Processes

While the primary function of Cml1 is its enzymatic activity as an N-acetyltransferase, its potential involvement in disease and various biological processes is an area of ongoing research. For example, Protein Tyrosine Phosphatase 1B (PTP1B) antagonizes signaling by p210 bcr-abl protein tyrosine kinase (PTK), which is directly responsible for chronic myelogenous leukemia (CML) . PTP1B recognizes p210 bcr-abl as a substrate in a cellular context .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
Cml1; Cml2; Probable N-acetyltransferase CML1; Camello-like protein 1; Camello-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Cml1
Target Protein Sequence
MAPYHIRQYQDSDHKSVVDVFTKGMEEHIPSTFRHMLMLPRTLLLLLGVPLALVLVSGSW LLAVVCIFFLLLLLRFLAGQPWKEYVATCLRTDMADITKSYLNAHGSFWVAESGNQVVGI VAALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETSTLQ QGAMTLYLGMGFQKTGQRFLTMFWRLVGIRTIQLKYPFPSA
Uniprot No.

Target Background

Function

May play a role in the regulation of gastrulation.

Database Links
Protein Families
Camello family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Rat Probable N-acetyltransferase CML1 and how does it relate to human N-acetyltransferases?

Recombinant Rat Probable N-acetyltransferase CML1 (Cml1) belongs to the N-acetyltransferase family of enzymes that catalyze the transfer of acetyl groups from acetyl coenzyme A to various substrates. Based on structural and functional homology, rat N-acetyltransferases can be compared to human arylamine N-acetyltransferase Type 1 (NAT1) and Type 2 (NAT2). These enzymes are involved in xenobiotic metabolism but also play significant roles in endogenous cellular processes.

Human NAT1 is expressed during early embryonic development (as early as the four-cell stage), in placenta throughout pregnancy, and in stem cells, suggesting important physiological functions beyond xenobiotic metabolism . Recent evidence indicates that human NAT1 and its murine homologue catalyze folate-dependent acetyl Coenzyme A hydrolysis, pointing to their involvement in folate metabolism . Rat CML1 likely shares some of these functional characteristics while possessing species-specific variations in substrate specificity and activity.

What biochemical characteristics distinguish Rat N-acetyltransferase CML1 from other N-acetyltransferases?

While specific biochemical characteristics of Rat CML1 require further characterization, insights can be gained from related N-acetyltransferases. N-acetyltransferases typically feature a catalytic triad consisting of cysteine, histidine, and aspartic acid residues essential for acetyl transfer reactions. Species variations in these enzymes often manifest in:

  • Substrate specificity profiles – affecting which compounds can be acetylated

  • Catalytic efficiency – determining reaction rates with specific substrates

  • Tissue distribution patterns – influencing physiological roles

  • Regulatory mechanisms – controlling expression and activity levels

For experimental design, researchers should consider that human NAT1 and mouse NAT2 can acetylate folate catabolites such as para-aminobenzoyl-1-glutamate (pABAglu) and para-aminobenzoic acid (pABA) . These enzymes also participate in folate metabolism through acetyl Coenzyme A hydrolysis, suggesting Rat CML1 may have similar capabilities that should be explored in functional assays.

How has the expression and purification of Recombinant Rat N-acetyltransferase CML1 been optimized for research applications?

Methodological optimization for recombinant Rat CML1 expression should address several key considerations:

  • Expression System Selection:

    • Prokaryotic systems (E. coli): Offer high yield but may require refolding

    • Eukaryotic systems: Provide proper post-translational modifications but with lower yield

    • Cell-free systems: Allow rapid production for initial characterization studies

  • Purification Strategy:

    • Affinity chromatography: His-tag or GST-fusion approaches facilitate rapid purification

    • Ion exchange chromatography: Helps remove contaminants based on charge differences

    • Size exclusion chromatography: Ensures monodisperse, properly folded enzyme preparations

  • Stability Considerations:

    • Buffer composition: pH, ionic strength, and reducing agents significantly impact stability

    • Storage conditions: Glycerol addition and flash-freezing protocols affect retained activity

    • Activity preservation: Addition of stabilizing agents such as BSA or specific substrates

Optimizing these parameters is essential for obtaining high-quality recombinant enzyme suitable for structural and functional studies.

What are the most effective assay systems for characterizing Rat N-acetyltransferase CML1 enzymatic activity?

To effectively characterize Rat CML1 enzymatic activity, researchers should implement multiple complementary assay systems:

  • Spectrophotometric Assays:

    • DTNB (Ellman's reagent) coupling to detect CoA formation

    • Colorimetric detection of acetylated product formation

    • Continuous monitoring of substrate depletion

  • Chromatographic Methods:

    • HPLC separation and quantification of acetylated products

    • LC-MS/MS for high sensitivity detection of metabolites

    • Radiochemical detection using labeled substrates for enhanced sensitivity

  • Folate-Dependent Activity Measurements:

    • Free acetate quantification to assess folate-dependent acetyl CoA hydrolysis

    • Monitoring CoA release in the presence of varying folate concentrations

    • Coupled enzyme assays to detect reaction products indirectly

When designing these assays, consider that in silico docking studies have suggested folate may bind at the enzyme's active site and facilitate acetyl Coenzyme A hydrolysis in human NAT1 . Similar binding characteristics should be investigated for Rat CML1 to fully understand its catalytic capabilities.

How should researchers design experiments to investigate polymorphisms in Rat N-acetyltransferase CML1?

For investigating Rat CML1 polymorphisms, researchers should implement a comprehensive experimental design incorporating:

  • Genotyping Strategies:

    • PCR-RFLP (polymerase chain reaction-restriction fragment length polymorphism) analysis using appropriate restriction enzymes to detect specific nucleotide changes

    • Direct sequencing for comprehensive polymorphism identification

    • Allele-specific PCR for rapid screening of known variants

  • Functional Characterization:

    • Recombinant expression of variant enzymes for in vitro activity comparisons

    • Kinetic parameter determination (Km, Vmax) with multiple substrates

    • Protein stability and expression level assessments

  • Experimental Design Considerations:

    • Case-control study design for disease association studies, as utilized in NAT2 polymorphism research

    • Sample size calculations to ensure adequate statistical power

    • Control for confounding variables such as age, sex, and environmental exposures

The table below illustrates potential genotyping approaches based on methodologies used for NAT2:

Polymorphism TypeRestriction EnzymeWild-type PatternVariant Pattern
Single NucleotideAppropriate RESpecific fragment sizesAltered fragment pattern
Insertion/DeletionGel electrophoresisReference band sizeSize shift
Copy NumberqPCRNormal copy numberIncreased/decreased copies

This methodological framework has proven effective in identifying protective NAT2 polymorphisms in chronic myeloid leukemia studies .

What experimental controls and validation strategies are essential when studying Rat CML1 interaction with potential substrates?

When investigating Rat CML1 substrate interactions, implementing robust controls and validation strategies is crucial:

  • Essential Controls:

    • Enzyme-free controls to account for non-enzymatic reactions

    • Heat-inactivated enzyme controls to confirm enzymatic nature of observed activity

    • Known substrate positive controls to verify enzyme functionality

    • Specific inhibitor controls to confirm reaction specificity

    • Species comparison controls using human and mouse homologues when available

  • Validation Approaches:

    • Multiple detection methods to confirm activity (e.g., spectrophotometric and chromatographic)

    • Concentration-dependence studies to establish enzyme kinetics

    • Site-directed mutagenesis of catalytic residues to confirm mechanism

    • Isothermal titration calorimetry or surface plasmon resonance for binding validation

  • Data Quality Assessment:

    • Replication across multiple enzyme preparations

    • Statistical analysis of variance components

    • Quality control metrics for assay performance (Z-factor, signal-to-noise ratio)

These validation strategies help address the challenge of distinguishing true substrate interactions from experimental artifacts, particularly important given evidence that N-acetyltransferases may have broader physiological roles than previously thought .

What evidence suggests a role for Rat N-acetyltransferase CML1 in folate metabolism?

Evidence supporting potential involvement of Rat CML1 in folate metabolism can be inferred from studies on related N-acetyltransferases:

  • Enzymatic Activity:

    • Human NAT1 and mouse NAT2 catalyze folate-dependent acetyl Coenzyme A hydrolysis

    • These enzymes can acetylate the folate catabolite para-aminobenzoyl-1-glutamate (pABAglu)

    • In silico docking studies demonstrate folate binding at the enzyme's active site

  • Developmental Evidence:

    • Mouse models with altered NAT expression show disrupted folate homeostasis

    • Overexpression of human NAT1 in mice provokes neural tube defects typically associated with folate deficiency

    • Knockout mouse studies suggest roles in folate catabolism

  • Molecular Interactions:

    • Folate and its analogues inhibit in vitro arylamine N-acetylation by recombinant human NAT1

    • Evidence suggests complex interactions between N-acetyltransferase activity and folate metabolism pathways

These findings collectively suggest that rat CML1 may share conserved roles in folate metabolism, warranting targeted investigation of its interactions with folate and related metabolites.

How can researchers experimentally differentiate between xenobiotic metabolism and endogenous functions of Rat N-acetyltransferase CML1?

Distinguishing between xenobiotic metabolism and endogenous functions requires methodological approaches that can separate these potentially overlapping roles:

  • Substrate Specificity Analysis:

    • Compare kinetic parameters for xenobiotic versus putative endogenous substrates

    • Competitive inhibition studies to determine substrate preference hierarchies

    • Structural analysis of enzyme-substrate complexes to identify binding determinants

  • Temporal and Spatial Expression Studies:

    • Developmental expression profiling to identify periods of high expression before xenobiotic exposure

    • Tissue-specific expression analysis compared to xenobiotic exposure patterns

    • Subcellular localization studies to determine relationship to metabolic compartments

  • Functional Genomics Approaches:

    • Gene silencing or knockout in developmental models to assess phenotypic consequences

    • Metabolomic profiling following enzyme modulation to identify affected pathways

    • Proteomic analysis to identify protein-protein interactions suggesting endogenous functions

This multifaceted approach acknowledges that N-acetyltransferases are "by no means just xenobiotic metabolising enzymes but probably also play an important role in cellular metabolism" .

What metabolic consequences might result from polymorphic variations in Rat N-acetyltransferase CML1?

Polymorphic variations in Rat CML1 could have significant metabolic consequences, as suggested by studies of NAT2 polymorphisms:

  • Altered Enzymatic Properties:

    • Changed substrate specificity profiles

    • Modified catalytic efficiency (Km and Vmax alterations)

    • Altered protein stability and expression levels

    • Different responses to regulatory mechanisms

  • Metabolic Pathway Impact:

    • Disrupted folate homeostasis, as suggested by neural tube defect association with altered NAT expression

    • Changes in xenobiotic detoxification capacity

    • Altered metabolic flux through connected pathways

    • Compensatory upregulation of alternative metabolic routes

  • Disease Susceptibility Consequences:

    • Certain NAT2 polymorphisms provide protection against chronic myeloid leukemia (CML)

    • The heterozygous NAT2 A803G polymorphism offers approximately 2.3-fold protection against CML

    • Both heterozygous (GA) and homozygous mutant (AA) variants of the G857A genotype decrease CML risk

The table below summarizes protective compound genotypes identified in NAT2 polymorphism studies:

NAT2 Compound GenotypeOdds Ratio95% CIP-value
NAT2 481CT/803AG0.0230.001-0.4560.013
NAT2 590GG/803AG0.0060.001-0.0570.000
NAT2 590AG/803AG0.0760.021-0.2740.000
NAT2 590AG/803GG0.1210.032-0.4480.000
NAT2 590AA/803AG0.0380.007-0.1970.000

These findings suggest that complex interactions between polymorphic variants may substantially alter metabolic consequences of CML1 variations .

How can Rat N-acetyltransferase CML1 be effectively utilized in cancer research models?

Rat N-acetyltransferase CML1 offers valuable opportunities for cancer research applications based on established connections between N-acetyltransferases and cancer:

  • Experimental Cancer Models:

    • Transgenic rat models with altered CML1 expression to study carcinogenesis susceptibility

    • Cell line models examining CML1 involvement in xenobiotic activation/detoxification

    • Pharmacological inhibition of CML1 in cancer models to assess therapeutic potential

  • Polymorphism-Disease Association Studies:

    • Case-control studies comparing CML1 polymorphism frequencies between cancer patients and controls

    • Functional analysis of CML1 variants identified in cancer tissues

    • Genotype-phenotype correlation studies examining cancer subtypes and progression

  • Mechanistic Investigations:

    • Studies of CML1 interaction with carcinogens and pro-carcinogens

    • Assessment of CML1 role in folate metabolism disruption in cancer cells

    • Examination of CML1 expression changes during carcinogenesis

This research direction is supported by findings that certain NAT2 polymorphisms provide protection against chronic myeloid leukemia, with the NAT2 A803G polymorphism in its heterozygous form offering approximately 2.3-fold protection .

What are the methodological considerations for designing Rat CML1 gene knockout or knockdown studies?

When designing gene modification studies for Rat CML1, researchers should address several methodological considerations:

  • Knockout Strategy Selection:

    • Global knockout: Eliminates expression in all tissues but may cause developmental effects

    • Conditional knockout: Allows temporal and tissue-specific deletion

    • Inducible systems: Enables controlled timing of gene inactivation

    • CRISPR-Cas9 approach: Provides precise genomic editing with minimal off-target effects

  • Knockdown Methodology:

    • siRNA: Transient reduction suitable for acute studies

    • shRNA: Stable reduction for long-term experiments

    • Antisense oligonucleotides: Alternative approach with different delivery characteristics

    • Validation of knockdown efficiency at both mRNA and protein levels

  • Phenotypic Analysis Framework:

    • Developmental assessment: Examine impacts on embryogenesis and growth

    • Biochemical profiling: Measure changes in relevant metabolic pathways

    • Challenge studies: Test responses to xenobiotics or metabolic stressors

    • Comprehensive controls: Include appropriate wild-type comparisons and rescue experiments

When interpreting results, researchers should consider that overexpression of human NAT1 in mice has been associated with poor survival and neural tube defects , suggesting CML1 has critical physiological functions that require careful experimental control.

How can conflicting data regarding Rat N-acetyltransferase CML1 function be systematically addressed in research studies?

Addressing conflicting data regarding Rat CML1 function requires systematic methodological approaches:

  • Standardization of Experimental Protocols:

    • Establish uniform enzyme preparation methods across laboratories

    • Standardize assay conditions (pH, temperature, buffer composition)

    • Develop reference standards for activity measurements

    • Create detailed protocols for replication studies

  • Comprehensive Characterization Approach:

    • Employ multiple complementary methodologies to assess function

    • Conduct side-by-side comparisons under identical conditions

    • Investigate enzyme behavior across physiologically relevant conditions

    • Consider impacts of post-translational modifications and protein interactions

  • Statistical and Analytical Considerations:

    • Perform power analyses to ensure adequate sample sizes

    • Implement blinded analysis protocols to minimize bias

    • Use appropriate statistical methods for data analysis

    • Conduct meta-analyses across multiple studies when possible

  • Biological Context Evaluation:

    • Distinguish between in vitro and in vivo activities

    • Consider species-specific and tissue-specific variations

    • Evaluate enzyme function within relevant metabolic networks

    • Assess developmental and physiological context

This systematic approach helps reconcile apparently conflicting results by identifying methodological differences or discovering context-dependent enzyme functions.

What emerging technologies offer new insights into Rat N-acetyltransferase CML1 structure-function relationships?

Advanced technologies are revolutionizing our understanding of enzyme structure-function relationships, offering promising avenues for Rat CML1 research:

  • Structural Biology Approaches:

    • Cryo-electron microscopy for high-resolution structural determination without crystallization

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

    • Molecular dynamics simulations to model substrate interactions and catalytic mechanisms

    • Time-resolved structural studies to capture enzymatic intermediates

  • Functional Genomics Tools:

    • CRISPR-Cas9 base editing for precise single nucleotide modifications

    • Single-cell enzyme activity assays to assess population heterogeneity

    • Spatial transcriptomics to map tissue-specific expression patterns

    • Ribosome profiling to examine translational regulation

  • Advanced Computational Methods:

    • Machine learning for substrate prediction and activity modeling

    • Quantum mechanics/molecular mechanics (QM/MM) simulations of catalytic mechanisms

    • Network analysis to position CML1 within metabolic pathways

    • In silico docking studies to predict interactions with potential substrates or inhibitors

These technologies can build upon foundational studies like those showing that folate may bind at human NAT1's active site and facilitate acetyl Coenzyme A hydrolysis , enabling similar investigations for Rat CML1.

How can researchers develop selective inhibitors or modulators of Rat N-acetyltransferase CML1 for experimental applications?

Developing selective CML1 modulators requires a systematic approach combining computational and experimental strategies:

  • Rational Design Strategy:

    • Structure-based design utilizing homology models or experimental structures

    • Fragment-based screening to identify initial binding scaffolds

    • Focused library design targeting the unique features of CML1 active site

    • Optimization of lead compounds for selectivity, potency, and physicochemical properties

  • Screening Methodology:

    • High-throughput enzymatic assays to identify initial hits

    • Counter-screening against related N-acetyltransferases to establish selectivity

    • Cell-based assays to confirm intracellular activity

    • ADME profiling for promising candidates

  • Validation Approaches:

    • Determination of inhibition mechanisms (competitive, noncompetitive, etc.)

    • Structural studies of enzyme-inhibitor complexes

    • Cellular target engagement assays

    • Phenotypic confirmation in relevant biological systems

Researchers can draw inspiration from the characterization of a naphthoquinone inhibitor of folate-dependent acetyl Coenzyme A hydrolysis by human NAT1 , potentially adapting similar approaches for Rat CML1-specific inhibitors.

What experimental approaches can determine if Rat N-acetyltransferase CML1 polymorphisms influence drug metabolism and therapeutic responses?

To investigate the impact of Rat CML1 polymorphisms on drug metabolism, researchers should implement a multi-faceted experimental framework:

  • In Vitro Metabolism Studies:

    • Recombinant expression of CML1 variants to assess catalytic differences

    • Kinetic analysis with clinically relevant drugs and xenobiotics

    • Metabolite profiling using LC-MS/MS to identify altered metabolic patterns

    • Inhibition studies to evaluate drug-drug interaction potential

  • Cellular and Ex Vivo Systems:

    • Primary hepatocyte cultures from animals with different CML1 genotypes

    • Precision-cut liver slices to maintain tissue architecture and cell-cell interactions

    • Reporter gene assays to assess downstream effects of altered metabolism

    • Co-culture systems to examine intercellular metabolic communication

  • In Vivo Pharmacokinetic Approaches:

    • Rat models with different CML1 genotypes to evaluate drug disposition

    • PBPK (physiologically-based pharmacokinetic) modeling to predict genotype effects

    • Tissue distribution studies to identify organ-specific impacts

    • Biomarker analysis to assess therapeutic response variation

This comprehensive approach parallels methodologies that have revealed protective effects of NAT2 polymorphisms against chronic myeloid leukemia , suggesting similar clinically relevant findings may emerge for Rat CML1 variants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.