Recombinant Rat Probable N-acetyltransferase CML2 (Cml2)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Rat Probable N-acetyltransferase CML2 (Cml2) is a protein that belongs to the N-acetyltransferase family. It is also known as camello-like 2 . This protein is similar to N-acetyltransferase 8 (NAT8), which is found in the kidney and liver and shares similarities with bacterial acetyltransferases involved in drug resistance .

Cml2 is the official symbol for the camello-like 2 protein . Aliases for this gene include Cml1, CML2, Cml6, Hcml2, Nat8, Nat8b, NAT8BP, and RGD621605 .

Basic Properties

PropertyDescription
Recommended NameProbable N-acetyltransferase CML2
EC Number2.3.1.-
SpeciesRat
Molecular WeightApproximately 31 kDa for rat NAT2 (N-acetyltransferase-2)
Cellular LocationEndoplasmic reticulum membrane, Endoplasmic reticulum-Golgi intermediate compartment membrane, Single-pass type II membrane protein
Post-translational ModificationThe protein is produced in an in vitro E. coli expression system .
PurificationAffinity purified

Function

Cml2 is involved in several biochemical functions, including :

  • 2,4,4-trimethyl-3-oxopentanoyl-CoA 2-C-propanoyl transferase activity

  • 2,6-dimethyl-5-methylene-3-oxo-heptanoyl-CoA C-acetyltransferase activity

  • 2-methylhexanoyl-CoA C-acetyltransferase activity

Cml2 participates in various pathways and has different roles, with functions including O-acyltransferase, S-malonyltransferase, N-palmitoyltransferase, acetyltransferase, S-succinyltransferase, lanosterol O-acyltransferase, C-palmitoyltransferase, 2,6-dimethyl-5-methylene-3-oxo-heptanoyl-CoA C-acetyltransferase, and succinyltransferase activities .

Expression and Production

Recombinant Rat Probable N-acetyltransferase CML2 (Cml2) is produced using an in vitro E. coli expression system . The recombinant protein includes a sequence corresponding to amino acids 75-165 of human NAT8B (NP_057431.2) .

Immunochemistry

CML2 Polyclonal antibody specifically detects CML2 in Human, Mouse, and Rat samples . It is validated for Western Blot, Immunohistochemistry, and Immunohistochemistry (Paraffin) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type during ordering for prioritized development.
Synonyms
Nat8f2; Cml2; N-acetyltransferase family 8 member 2; Camello-like protein 2; N-acetyltransferase-like protein CML2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Cml2
Target Protein Sequence
MAPYHIRQFQDRDHRRVLDLFSRGMEEHVPAAFYHVLTLPHSLLLFPGVPVTIILVSGSW LLATVYSFLFLLCLRLIFWVSCRNYVAKCLQADLADITKSYLNAHGSFWVAESGGQVVGI VAALPVKEPPSGRKQLQLFRLSVSSQHRGQGIAKALVRIVLQFARDQGYTDVVLVTGNMQ YSAISLYQGMGFQKTGHYFVSIAKRLIGLSIFHFTYSLPSVWEPRM
Uniprot No.

Target Background

Function
Probable acetyltransferase (Probable). Exhibits no detectable histone acetyltransferase activity towards histone H3 or H4.
Database Links

KEGG: rno:100910829

UniGene: Rn.225883

Protein Families
Camello family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining CML2 activity?

For short-term storage, maintain Recombinant Rat Probable N-acetyltransferase CML2 at 4°C for up to one week in working aliquots. For extended storage, the protein should be kept at -20°C or preferably -80°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein. Repeated freeze-thaw cycles should be avoided to maintain enzymatic activity and structural integrity .

How does Recombinant Rat CML2 structurally compare to other N-acetyltransferases?

Recombinant Rat CML2 belongs to the N-acetyltransferase family but exhibits distinct structural features. While rat NAT1 and NAT2 consist of 290 amino acids with molecular weights of 33-34 kDa, CML2 is a shorter protein with 226 amino acids. SDS-PAGE/Western blot analysis of recombinant acetyltransferases has shown apparent relative molecular weights of approximately 31 kDa for rat NAT1 and NAT2, whereas CML2 likely has a different molecular profile due to its shorter sequence length .

What are the expected kinetic parameters when working with Recombinant Rat CML2?

While specific kinetic parameters for CML2 are not directly reported in the available literature, comparative studies of rat N-acetyltransferases provide insight into expected ranges. Rat NAT2 shows first-order increases in N-acetylation rates with increasing substrate concentrations between 5 and 100 μM, with apparent Km values of 22-32 μM for 2-aminofluorene (2-AF) and 62-138 μM for 4-aminoazobenzene (AAB). By contrast, rat NAT1 exhibits different kinetics with apparent Km values of 0.2-0.9 μM for the same substrates. These values provide a reference framework when investigating CML2 activity .

How can researchers accurately measure CML2 enzymatic activity?

CML2 enzymatic activity can be measured using established protocols for N-acetyltransferases:

  • N-acetyltransferase assay: Measure the rate of acetyl coenzyme A-dependent N-acetylation of model substrates such as 2-aminofluorene (2-AF) or 4-aminoazobenzene (AAB).

  • Substrate concentration range: Based on related N-acetyltransferases, test substrate concentrations between 5-100 μM to establish proper enzyme kinetics.

  • Visual verification: For preliminary assessments, a simple visual test observing the decolorization of 4-aminoazobenzene in medium by acetylation can indicate active enzyme .

  • HPLC analysis: Quantify acetylated products using high-performance liquid chromatography to determine precise rates of catalysis.

What experimental controls should be included when studying CML2 activity?

When studying CML2 activity, include the following controls:

  • Heat-inactivated enzyme: To verify that product formation is enzymatic rather than spontaneous.

  • Omission of acetyl-CoA: To verify dependency on the co-substrate.

  • Substrate concentration gradient: To establish Michaelis-Menten kinetics.

  • pH range test: To determine optimal reaction conditions.

  • Comparison with other N-acetyltransferases: Include parallel assays with rat NAT1 and NAT2 to benchmark relative activity and substrate specificity .

What expression systems are most effective for producing functional Recombinant Rat CML2?

Based on successful expression of related rat N-acetyltransferases, the following expression systems are recommended:

  • Bacterial expression: Escherichia coli has been successfully used for expressing functional rat NAT1 and NAT2 and would likely be suitable for CML2. Select a strain optimized for mammalian protein expression with appropriate codon usage .

  • Expression plasmid selection: Use vectors containing promoters that allow controlled induction (e.g., T7 promoter with IPTG induction).

  • Fusion tag considerations: A tag type appropriate for this protein should be determined during the production process to optimize solubility and facilitate purification .

  • Growth conditions: Optimize temperature (typically 16-25°C post-induction) to enhance proper folding and reduce inclusion body formation.

What purification strategy yields the highest CML2 activity?

A multi-step purification approach is recommended:

  • Initial capture: Affinity chromatography based on the fusion tag determined during production optimization .

  • Intermediate purification: Ion exchange chromatography to remove contaminants based on charge differences.

  • Polishing step: Size exclusion chromatography to obtain homogeneous enzyme preparation.

  • Buffer optimization: Finalize purification in Tris-based buffer with 50% glycerol to maintain stability .

  • Activity assessment: Regularly test fractions for enzymatic activity to ensure purification conditions preserve functional integrity.

How does CML2 contribute to xenobiotic metabolism compared to other N-acetyltransferases?

While specific data for CML2 is limited, comparative analysis with other N-acetyltransferases suggests potential roles:

  • Substrate specificity differences: Unlike NAT1 and NAT2, which show differential affinities for arylamines with NAT2 exhibiting higher Km values (22-138 μM) than NAT1 (0.2-0.9 μM), CML2 may have unique substrate preferences that complement these enzymes .

  • Potential complementary roles: CML2 may catalyze the N-acetylation of substrates not efficiently processed by NAT1 or NAT2, contributing to a comprehensive xenobiotic metabolism system.

  • Tissue distribution implications: While not explicitly documented for CML2, differential tissue expression patterns could indicate specialized roles in specific organs analogous to the NAT1/NAT2 system .

How can CML2 research contribute to understanding genetic polymorphism effects in drug metabolism?

Research on N-acetyltransferase polymorphisms has shown significant impacts on xenobiotic metabolism:

  • Genotype-dependent metabolism: Studies with NAT2 variants have demonstrated that genetic polymorphisms significantly affect N-acetylation rates and subsequent genotoxicity of compounds like MOCA (4,4′-Methylenebis(2-chloroaniline)) .

  • Research model development: Establish CML2 polymorphic variants in experimental systems similar to those used for NAT2 (e.g., transfected CHO cells) to assess functional differences .

  • Comparative analysis framework: As with NAT2 variants like NAT24, NAT25B, and NAT2*7B that show differential acetylation capacities, potential CML2 variants could be investigated for metabolism rate differences .

  • Risk assessment applications: Investigation of CML2 variants could help identify subpopulations potentially at higher risk for toxicity from specific environmental or pharmaceutical compounds, similar to NAT2 polymorphism effects on MOCA-induced mutagenicity .

What cell models are most appropriate for studying CML2 function in a physiologically relevant context?

Several cell models offer advantages for CML2 research:

  • Primary rat hepatocytes: Provide the most physiologically relevant model with native expression levels and cellular machinery.

  • DNA repair-deficient cell lines: NER-deficient Chinese hamster ovary (CHO) cells transfected with CML2 allow assessment of genotoxicity without repair confounding variables, similar to successful studies with NAT2 .

  • Cryopreserved rat hepatocytes: Offer a standardized model that maintains metabolic capacity while allowing for batch consistency in experiments.

  • Engineered cell lines: Develop metabolically competent cells expressing CML2 alongside relevant Phase I enzymes (e.g., CYP1A2) to study complete metabolic pathways .

How can researchers address data variability and reproducibility challenges in CML2 enzymatic assays?

To enhance reproducibility in CML2 enzyme assays:

  • Standardized enzyme preparation: Utilize consistent expression and purification protocols to minimize batch-to-batch variability .

  • Kinetic parameter determination: Establish complete enzyme kinetic profiles (Km, Vmax) under standardized conditions to enable meaningful comparisons between laboratories.

  • Reference substrates: Identify and use standard substrates with well-characterized acetylation profiles as positive controls in every assay.

  • Internal standards: Include internal standards for quantification methods to account for analytical variability.

  • Multiple detection methods: Employ complementary analytical techniques (spectrophotometric, HPLC, mass spectrometry) to confirm activity measurements.

What are the key considerations when designing experiments to evaluate CML2's role in toxicology studies?

When designing toxicology experiments involving CML2:

  • Substrate selection relevance: Choose environmentally or pharmaceutically relevant compounds that may undergo N-acetylation.

  • Concentration range determination: Test physiologically relevant concentrations based on known exposure scenarios (e.g., MOCA urine levels in humans have exceeded 400 μM) .

  • Metabolic pathway mapping: Include experiments to identify both detoxification and bioactivation pathways, as N-acetylation can lead to either outcome depending on the substrate.

  • Multiple endpoint assessment: Measure various toxicological endpoints (mutagenicity, DNA damage, oxidative stress) to comprehensively evaluate effects, as demonstrated in NAT2 studies with MOCA .

  • In vitro to in vivo extrapolation: Develop scaling factors and physiologically based models to translate in vitro findings to predicted in vivo outcomes.

How might CML2 contribute to bioremediation applications similar to bacterial CML2?

While rat Probable N-acetyltransferase CML2 and bacterial C. metallidurans CML2 share a name but likely have different functions, comparative study could yield valuable insights:

  • Functional convergence exploration: Investigate whether mammalian CML2 might share any detoxification capabilities with the bacterial strain that shows remarkable heavy metal tolerance.

  • Xenobiotic metabolism comparison: Compare detoxification pathways between the mammalian enzyme and bacterial systems to identify potential novel applications .

  • Evolutionary relationship analysis: Explore whether there are evolutionary relationships or functional parallels between these similarly named but seemingly distinct proteins.

  • Translational research potential: Examine whether insights from bacterial CML2's remarkable cadmium remediation properties (tolerance to 2400 mg/L Cd(II)) could inform biotechnology applications of mammalian CML2 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.