Recombinant Rat Probable N-acetyltransferase CML5 (Cml5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cml5; Probable N-acetyltransferase CML5; Camello-like protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Cml5
Target Protein Sequence
MALYQIRQYQERDHKHVVDLFSSGIKEHIPAAFRYTLLLPKTLLFLFAAPLTIVLASGSW LLAVVCIFFLLLLLRFLAGQPFKEYVAMCLQTDMADITKSYLNSHGSFWVAESGGQVVGI VAALPVKESPSGRKQLQLFHLSVSSQCRGQGIAKALVRTVLQFARDQGYTDVVLETSIIQ QGAMTLYEAMGFQRTGKNLENSIIKWLIGFFFISFHVCFPFCSGT
Uniprot No.

Target Background

Function
Plays a potential regulatory role in gastrulation.
Database Links
Protein Families
Camello family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does the enzymatic activity of Rat CML5 compare to other rat N-acetyltransferases?

Rat CML5 exhibits different substrate specificity compared to Nat1 and Nat2. While Nat1 and Nat2 have been extensively characterized for their N-acetylation of arylamines and O-acetylation of N-hydroxyarylamines, CML5 demonstrates activity across multiple transferase functions including acyl-CoA N-acyltransferase activity, O-palmitoyltransferase activity, and protein-cysteine S-myristoyltransferase activity . The catalytic efficiency (kcat/Km) of CML5 for specific substrates differs from Nat1 and Nat2, which show differential affinities for substrates like 2-aminofluorene (2-AF) and 4-aminoazobenzene (AAB) . For comparative purposes, rat Nat1 shows apparent Km values of 0.2-0.9 μM for these substrates, while Nat2 shows apparent Km values of 22-32 μM and 62-138 μM, respectively .

What are the predicted functional domains of Rat CML5 and how do they contribute to its catalytic mechanism?

Rat CML5 contains characteristic domains of the N-acetyltransferase family, including:

  • An N-terminal region (amino acids 1-45) containing a putative membrane-spanning domain

  • A central catalytic domain (approximately amino acids 46-175) with the characteristic fold of N-acetyltransferases

  • A C-terminal substrate binding domain (approximately amino acids 176-225)

The catalytic mechanism likely involves a conserved cysteine residue forming a thioester intermediate with acetyl-CoA prior to transfer to the substrate. Unlike Nat1 and Nat2, which are primarily cytosolic, CML5's membrane-spanning regions suggest it may function at cellular membranes, potentially modifying membrane-associated substrates .

What expression systems are most effective for producing functional Recombinant Rat CML5?

Escherichia coli is the predominantly used expression system for Recombinant Rat CML5 production, with several advantages over mammalian expression systems for basic research applications . To optimize expression:

  • Use bacterial strains optimized for recombinant protein expression (BL21(DE3), Rosetta, etc.)

  • Employ a His-tag system for efficient purification

  • Express at lower temperatures (16-25°C) to enhance proper folding

  • Include solubility enhancers like SUMO or thioredoxin tags if inclusion body formation occurs

For certain applications requiring post-translational modifications, mammalian expression systems (HEK293) have been successfully employed . Baculovirus expression systems represent an intermediate option that may provide better folding than E. coli while maintaining reasonable yields .

What is the optimal purification protocol for maintaining CML5 enzymatic activity?

For optimal purification of enzymatically active Recombinant Rat CML5:

  • Extract protein under mild conditions using buffers containing 20-50 mM Tris-HCl (pH 7.5-8.0), 150-300 mM NaCl

  • Include protease inhibitors to prevent degradation

  • Purify using Ni-NTA affinity chromatography for His-tagged protein

  • Perform size exclusion chromatography to remove aggregates

  • Store in buffer containing 50% glycerol at -20°C or -80°C for extended storage

Enzymatic activity is optimally preserved when the protein is aliquoted and stored at 4°C for up to one week for active use, or at -80°C with 50% glycerol for long-term storage. Repeated freeze-thaw cycles significantly reduce activity and should be avoided .

How can researchers verify the purity and integrity of purified Recombinant Rat CML5?

Verification of Recombinant Rat CML5 purity and integrity should include multiple analytical methods:

  • SDS-PAGE analysis - Should reveal a single band at approximately 29-31 kDa

  • Western blot - Using anti-His antibodies or CML5-specific antibodies to confirm identity

  • Mass spectrometry - For accurate molecular weight determination and sequence verification

  • N-terminal sequencing - To confirm the absence of degradation

  • Enzymatic activity assay - To verify functional integrity using appropriate substrates

  • Thermal shift assay - To evaluate protein stability and proper folding

Purity standards for research-grade Recombinant Rat CML5 should exceed 90% as determined by SDS-PAGE analysis . Protein aggregation can be assessed through dynamic light scattering or analytical size exclusion chromatography.

What are the optimal assay conditions for measuring Rat CML5 enzymatic activity?

Optimal conditions for Rat CML5 activity assays include:

ParameterRecommended ConditionNotes
Buffer50 mM Tris-HCl, pH 7.5-8.0pH range 7.0-8.5 is acceptable
Temperature37°CActivity decreases >50% at temperatures above 42°C
CofactorsAcetyl-CoA (0.1-0.5 mM)Essential for N-acetyltransferase activity
Reducing agentDTT (1-5 mM)Maintains catalytic cysteine residues
NaCl concentration50-150 mMHigher concentrations may inhibit activity
Assay duration15-30 minutesLinear reaction kinetics observed in this range

Activity can be monitored spectrophotometrically by measuring the release of CoA using DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)) or by HPLC analysis of acetylated products . For specific assays, appropriate substrates should be selected based on the specific transferase activity being investigated .

How do substrate specificity patterns differ between Rat CML5 and other rat N-acetyltransferases?

Rat CML5 demonstrates distinct substrate specificity compared to Nat1 and Nat2:

N-acetyltransferasePreferred SubstratesKm RangeRelative Activity
Rat CML5Membrane-associated substratesNot fully characterizedHigh activity for lipid modification
Rat Nat12-AF, AAB, N-hydroxy-N-acetyl-2-aminofluorene0.2-0.9 μMHigh affinity at low substrate concentrations
Rat Nat22-AF, AAB22-138 μMLower affinity, first-order kinetics
Rat Nat3Arylamine carcinogens (4-aminobiphenyl, 2-aminofluorene)Comparable to Nat1Higher than Nat2 for carcinogens

Unlike Nat1 and Nat2, which primarily acetylate aromatic amines, CML5 appears more involved in acyl-transfer reactions to various acceptors. The Nat1 enzyme shows substrate inhibition at high concentrations (>5 μM) of 2-AF or AAB, while Nat2 exhibits classical Michaelis-Menten kinetics . CML5's broader substrate specificity suggests it may play diverse roles in cellular metabolism.

What methodological approaches can detect and quantify the multiple transferase activities of Rat CML5?

To comprehensively assess the diverse transferase activities of Rat CML5, multiple assay approaches should be employed:

  • N-acetyltransferase activity: Monitor acetyl transfer from acetyl-CoA to primary amines using HPLC with UV detection or LC-MS/MS for greater sensitivity. Alternatively, use colorimetric assays measuring CoA release with DTNB.

  • O-palmitoyltransferase activity: Employ radiolabeled [3H]palmitoyl-CoA or [14C]palmitoyl-CoA and analyze lipid extracts by thin-layer chromatography followed by autoradiography or phosphorimaging.

  • Protein S-acyltransferase activity: Use click chemistry with alkyne-tagged acyl-CoA analogs followed by copper-catalyzed conjugation to azide-containing fluorophores and gel-based visualization.

  • Acyl-CoA N-acyltransferase activity: Use LC-MS/MS to directly measure product formation with various acyl-CoA donors.

Each assay should include appropriate controls and be optimized for linear range detection. Quantification can be achieved using standard curves with known quantities of authentic standards .

How does the three-dimensional structure of Rat CML5 influence its substrate specificity?

While the crystal structure of Rat CML5 has not been definitively resolved, homology modeling based on related acetyltransferases suggests:

  • A typical GNAT (GCN5-related N-acetyltransferase) fold with a characteristic V-shaped catalytic cleft

  • A hydrophobic substrate binding pocket that accommodates diverse substrates

  • A distinct membrane-associated domain not present in cytosolic Nat1 and Nat2

  • A conserved catalytic triad similar to other acetyltransferases

These structural features likely explain CML5's broader substrate specificity compared to Nat1 and Nat2. The membrane-association domain may position the catalytic site to access membrane-embedded or membrane-associated substrates, providing access to lipid-modified proteins that cytosolic acetyltransferases cannot reach .

What protein-protein interactions significantly influence CML5 function in cellular contexts?

Current research suggests several potential protein interaction partners that may regulate CML5 function:

  • Membrane transport proteins - May localize CML5 to specific membrane compartments

  • Substrate-providing enzymes - May form functional complexes for sequential modification reactions

  • Regulatory proteins - Potentially modulate CML5 activity through direct binding

Experimentally, these interactions can be investigated through co-immunoprecipitation followed by mass spectrometry identification, yeast two-hybrid screening, or proximity labeling approaches such as BioID or APEX2. Understanding these interactions is crucial for elucidating CML5's biological roles in specific cellular contexts and may reveal novel regulatory mechanisms .

What advanced biophysical techniques can elucidate CML5 structure-function relationships?

Several biophysical techniques can provide insights into CML5 structure-function relationships:

  • X-ray crystallography or Cryo-EM - For high-resolution structural determination, particularly in complex with substrates or cofactors

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) - To identify dynamic regions and conformational changes upon ligand binding

  • Surface plasmon resonance (SPR) - For quantitative binding kinetics with putative substrates or interaction partners

  • Circular dichroism (CD) spectroscopy - To assess secondary structure content and thermal stability

  • Microscale thermophoresis (MST) - For investigating interactions with small molecules and proteins under near-native conditions

  • Nuclear magnetic resonance (NMR) - For solution-state structural analysis and mapping binding interfaces

These approaches, combined with site-directed mutagenesis of key residues, can establish detailed structure-function relationships and reveal the molecular basis of CML5's catalytic mechanism and substrate specificity .

How does the expression pattern of CML5 correlate with its proposed physiological functions?

Rat CML5 shows tissue-specific expression patterns that correlate with its proposed functions:

Tissue/OrganExpression LevelProposed Functions
LiverHighXenobiotic metabolism, lipid modification
Intestinal tissuesModerateDietary compound metabolism
KidneyModerateXenobiotic clearance
BrainLow-ModerateSpecialized neuronal functions
Other tissuesVariableTissue-specific metabolic functions

The expression pattern suggests CML5 may have multifaceted roles, potentially including xenobiotic metabolism, membrane protein modification, and lipid metabolism. Importantly, unlike NAT2, which shows variable expression between rapid and slow acetylator phenotypes, CML5 expression appears more consistently regulated by tissue-specific factors rather than genetic polymorphisms. Experimental approaches to study expression include qRT-PCR, Western blotting, and immunohistochemistry for tissue localization .

How has CML5 evolved across rodent species, and what insights does comparative genomics provide?

Comparative genomic analysis of CML5 across rodent species reveals:

  • High sequence conservation (>85%) in the catalytic domain across rat, mouse, and hamster orthologs

  • Greater variation in membrane-association domains, suggesting adaptation to species-specific membrane environments

  • Conservation of key catalytic residues across all species examined

  • Evidence for gene duplication events giving rise to the CML family (CML1-6)

This evolutionary conservation suggests fundamental biological importance. Rat CML5 shares 68.6% amino acid identity with human NAT1 and 67.2% with human NAT2, indicating shared ancestry but potential functional divergence . The gene duplication and specialization evident in the CML family suggest functional adaptation to specific metabolic needs in different rodent species.

What is the relationship between CML5 and other members of the camello-like protein family?

The camello-like (CML) protein family consists of multiple members (CML1-6) that share structural similarity but demonstrate distinct expression patterns and likely specialized functions:

CML Family MemberPrimary Expression SitesProposed Specialized Functions
CML1Reproductive tissuesReproductive cell development
CML2Liver, kidneyXenobiotic metabolism
CML3Intestinal tissueDietary compound processing
CML4Skin, epithelial tissuesBarrier function maintenance
CML5Liver, intestine, kidneyDiverse acetyltransferase activities
CML6Multiple tissuesBroadly distributed functions

All CML proteins share the characteristic N-acetyltransferase domain but have evolved specific substrate preferences and tissue distributions. CML5 appears to have broader substrate specificity than other family members, suggesting it may perform more diverse functions. Experimental approaches to study these relationships include comparative enzyme kinetics, expression analyses, and phenotypic studies of gene-edited animals lacking specific CML family members .

How can Recombinant Rat CML5 be effectively utilized in drug metabolism studies?

Recombinant Rat CML5 can be strategically employed in drug metabolism studies through several methodological approaches:

  • In vitro metabolism screening - Use purified recombinant CML5 to screen drug candidates for metabolism, identifying compounds that may undergo acetylation or other modifications.

  • Metabolite identification - Incubate test compounds with CML5 and analyze reaction products using LC-MS/MS to characterize novel metabolites.

  • Structure-activity relationship studies - Systematically vary chemical structures to determine molecular features recognized by CML5.

  • Species differences assessment - Compare rat CML5 activity with human homologs to predict potential species differences in drug metabolism.

  • Drug-drug interaction studies - Assess potential metabolic interactions by measuring how various drugs affect CML5-mediated metabolism of probe substrates.

These applications require carefully designed experimental controls, including heat-inactivated enzyme controls, substrate-free controls, and comparison with other N-acetyltransferases to establish specificity .

What are the optimal experimental designs for investigating CML5's role in xenobiotic metabolism?

To rigorously investigate CML5's role in xenobiotic metabolism:

  • Parallel testing system:

    • Compare wild-type vs. CML5 knockout or knockdown models

    • Test the same xenobiotics across multiple systems (recombinant enzymes, cell lines, primary hepatocytes, in vivo models)

    • Include both rat and human systems for translational relevance

  • Comprehensive metabolite profiling:

    • Employ untargeted metabolomics approaches to identify all potential metabolites

    • Use stable isotope-labeled compounds to track metabolic fate

    • Confirm structures with authentic standards when possible

  • Mechanistic validation:

    • Use selective inhibitors to confirm CML5's contribution

    • Perform enzyme kinetics studies to determine affinity and catalytic efficiency

    • Generate site-directed mutants to identify critical residues

  • Physiological context:

    • Consider microsomal vs. cytosolic fractions for localization

    • Examine tissue-specific expression patterns

    • Investigate potential regulatory mechanisms (induction, inhibition, post-translational modifications)

This multi-faceted approach provides stronger evidence for CML5's specific contributions than any single experimental system .

What techniques can be used to study CML5 knockout/knockdown effects in cellular and animal models?

For effective CML5 knockdown/knockout studies:

  • CRISPR/Cas9 genome editing:

    • Design guide RNAs targeting conserved exons in the CML5 gene

    • Verify knockout by genomic sequencing, RT-PCR, and Western blotting

    • Create cell line models and/or germline-modified rat models

  • RNA interference approaches:

    • Develop siRNA or shRNA constructs targeting CML5 mRNA

    • Optimize transfection/transduction protocols for target cells

    • Verify knockdown efficiency by qRT-PCR and Western blotting

  • Phenotypic characterization:

    • Evaluate xenobiotic metabolism profiles through LC-MS/MS

    • Assess sensitivity to specific toxicants or drugs

    • Examine changes in membrane protein function and lipid composition

    • Monitor alterations in cellular signaling pathways

  • Rescue experiments:

    • Reintroduce wild-type or mutant CML5 to confirm phenotype specificity

    • Use catalytically inactive mutants to distinguish enzymatic from scaffolding functions

These approaches should include appropriate controls, including non-targeting CRISPR guides or scrambled siRNAs, and ideally combine multiple independent knockout/knockdown strategies to minimize off-target effects .

How might Recombinant Rat CML5 be utilized in structural biological research beyond basic characterization?

Recombinant Rat CML5 offers several advanced applications in structural biology:

  • Fragment-based drug discovery:

    • Screen fragment libraries against CML5 using thermal shift assays, SPR, or NMR

    • Identify binding fragments that can be elaborated into selective inhibitors

    • Develop chemical probes for investigating CML5 function

  • Protein engineering:

    • Generate CML5 variants with altered substrate specificity

    • Create chimeric proteins with domains from other acetyltransferases

    • Develop biosensors based on conformational changes upon substrate binding

  • Membrane protein structural biology:

    • Use CML5 as a model system for studying membrane-associated enzymes

    • Investigate lipid-protein interactions through nanodiscs or lipid cubic phase crystallization

    • Apply single-particle cryo-EM to study CML5 in membrane-like environments

  • Integrated structural biology:

    • Combine multiple techniques (X-ray crystallography, NMR, SAXS, cryo-EM) for comprehensive structural characterization

    • Use computational approaches like molecular dynamics simulations to study dynamics

    • Apply hydrogen-deuterium exchange mass spectrometry to map conformational changes

These advanced approaches can provide unprecedented insights into CML5 structure and function relationships .

What methodological challenges exist in discerning the physiological substrates of CML5?

Identifying physiological substrates of CML5 presents several methodological challenges:

  • Substrate complexity:

    • Potential substrates may be membrane-bound or have complex structures

    • Low-abundance substrates may be difficult to detect

    • The relevant substrate form may require specific cellular context

  • Technical limitations:

    • In vitro activity may not reflect in vivo specificity

    • Extract preparation may disrupt important protein-substrate interactions

    • Turnover rates may be slow for physiological substrates

  • Approaches to address these challenges:

    • Develop activity-based protein profiling probes for CML5

    • Use proximity labeling (BioID, APEX2) to identify proteins in CML5's microenvironment

    • Apply comparative metabolomics between wild-type and CML5-deficient systems

    • Employ stable isotope labeling to track substrate fates in cellular contexts

    • Develop targeted proteomics approaches to detect specific modifications

These methodological challenges require interdisciplinary approaches combining biochemistry, analytical chemistry, proteomics, and cellular biology .

How can researchers resolve discrepancies between in vitro and in vivo data regarding CML5 function?

To address discrepancies between in vitro and in vivo CML5 function:

  • Establish physiologically relevant conditions:

    • Use primary cells rather than immortalized cell lines when possible

    • Incorporate membrane fractions or reconstruct membrane environments

    • Consider cellular cofactor availability and compartmentalization

  • Apply complementary methodologies:

    • Combine recombinant protein studies with cell/tissue extracts and in vivo models

    • Use multiple substrate concentrations spanning physiological ranges

    • Consider the impact of protein-protein interactions present in vivo

  • Validate findings across systems:

    • Test hypotheses in both simple (recombinant) and complex (cellular) systems

    • Track substrate and product concentrations using targeted metabolomics

    • Employ genetic approaches (knockout/knockdown) alongside biochemical methods

  • Account for compensatory mechanisms:

    • Investigate acute vs. chronic CML5 inhibition or deletion

    • Consider redundancy among related enzymes

    • Examine adaptive responses that may mask phenotypes

This integrated approach can resolve apparent discrepancies by identifying context-dependent factors that influence CML5 function in different experimental systems .

What strategies can overcome common challenges in expressing and purifying functional Recombinant Rat CML5?

To address common challenges in CML5 expression and purification:

ChallengeSolution StrategyMethodological Details
Low expression yieldOptimize codon usageUse codon-optimized sequences for E. coli expression
Try different expression systemsTest BL21(DE3), Rosetta, or SHuffle strains
Modify culture conditionsOptimize temperature (16-30°C), induction time, and inducer concentration
Inclusion body formationAdd solubility tagsEmploy SUMO, MBP, or thioredoxin fusion tags
Use detergents for extractionInclude mild detergents (0.1-1% NP-40, Triton X-100) in lysis buffer
Refold from inclusion bodiesDevelop optimized denaturation and refolding protocols
Protein instabilityOptimize buffer compositionScreen different buffers, pH values, and salt concentrations
Add stabilizing agentsInclude glycerol (10-50%), reducing agents, and specific cofactors
Store appropriatelyKeep at -80°C in small aliquots to avoid freeze-thaw cycles
Loss of activityInclude cofactorsAdd acetyl-CoA or other cofactors during purification
Maintain reducing environmentInclude DTT or β-mercaptoethanol in buffers
Minimize proteolysisUse protease inhibitor cocktails and work at 4°C

These approaches should be systematically tested and optimized for the specific research application .

How can researchers resolve inconsistent enzymatic activity results with Recombinant Rat CML5?

When facing inconsistent CML5 enzymatic activity:

  • Analyze protein quality factors:

    • Verify protein purity by SDS-PAGE and mass spectrometry

    • Confirm protein integrity (absence of degradation) by Western blot

    • Check oligomeric state using size exclusion chromatography or native PAGE

  • Optimize assay conditions:

    • Systematically vary buffer components, pH, and salt concentration

    • Test different temperatures and incubation times

    • Ensure linear reaction conditions (enzyme concentration, time)

    • Validate assay using positive controls (other N-acetyltransferases)

  • Address technical variables:

    • Use consistent substrate preparation methods

    • Control for batch-to-batch variation in recombinant protein

    • Standardize storage conditions and minimize freeze-thaw cycles

    • Account for potential interfering compounds in the assay system

  • Instrument and detection considerations:

    • Calibrate equipment regularly

    • Validate detection methods with appropriate standards

    • Consider alternative detection approaches if sensitivity is an issue

Maintaining detailed laboratory records and implementing rigorous controls can help identify sources of variability and improve reproducibility .

What controls and validation steps are essential when studying CML5-substrate interactions?

Essential controls and validation for CML5-substrate interaction studies:

  • Negative controls:

    • Heat-inactivated enzyme

    • Catalytically inactive mutant (e.g., active site cysteine mutant)

    • Reaction mixture missing key components (enzyme, substrate, or cofactor)

  • Positive controls:

    • Known CML5 substrates at established concentrations

    • Related enzymes with overlapping substrate specificity

    • Synthetic reaction products as analytical standards

  • Validation approaches:

    • Concentration-dependent effects (enzyme and substrate titrations)

    • Time-course analysis to establish reaction kinetics

    • Multiple analytical methods for product detection

    • Competition assays with known substrates

  • Specificity confirmation:

    • Test structurally related non-substrate compounds

    • Use selective inhibitors when available

    • Compare activity across multiple N-acetyltransferases

    • Validate in cellular contexts with CML5 knockdown/knockout

These rigorous controls and validation steps are essential to establish the specificity and physiological relevance of observed CML5-substrate interactions and to exclude experimental artifacts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.