Recombinant Rat Probable N-acetyltransferase CML6 (Cml6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Cml6; Cml1; Probable N-acetyltransferase CML6; Camello-like protein 1; Camello-like protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Cml6
Target Protein Sequence
MVSYHICEYQDSDYKSVVDVFTKGAEEYIPSTFRHLLLLPRTLLLLLGVSLALVLVSGSW LLAVVCIFFLLPFLWFLAGQPWKNYVSKCLHTDMADITKSYLSDRGSGFWVAESGEQVVG TVGALPVKEPPSGRKQLQLFHLAVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETSTM QIGAVTLYLGMGFQKTGQYFPSMLWRLVGIRFVQLNYSFPSA
Uniprot No.

Target Background

Function
May play a regulatory role in gastrulation.
Database Links

KEGG: rno:103690139

UniGene: Rn.3643

Protein Families
Camello family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Rat Probable N-acetyltransferase CML6?

Recombinant Rat Probable N-acetyltransferase CML6 (Cml6) is a recombinant protein expressed in heterologous systems, typically E. coli, that corresponds to the full-length rat N-acetyltransferase enzyme. The protein consists of 222 amino acids and is commonly produced with an N-terminal histidine tag to facilitate purification . This enzyme belongs to the N-acetyltransferase family, which catalyzes the transfer of acetyl groups from acetyl coenzyme A to various substrates, particularly aromatic amines and hydrazines. Unlike the well-characterized NAT1 and NAT2 isozymes, CML6 represents a distinct class of N-acetyltransferases with potentially specialized functions in xenobiotic metabolism.

How does Recombinant Rat CML6 differ structurally from other N-acetyltransferases?

Recombinant Rat CML6 differs from other N-acetyltransferases (NATs) in several key aspects:

  • Molecular Weight: While NAT1 and NAT2 isozymes from rat have apparent molecular weights of approximately 31 kDa as determined by SDS-PAGE/Western blot analysis , Recombinant Rat CML6 has a reported molecular weight corresponding to its 222 amino acid sequence .

  • Sequence Homology: CML6 shows limited sequence homology with the canonical NAT1 (290 amino acids) and NAT2 (290 amino acids) enzymes , suggesting divergent evolutionary paths and potentially distinct substrate preferences.

  • Catalytic Triad: Like other NATs, CML6 likely contains a catalytic triad essential for acetylation activity, though the specific amino acid residues and their spatial arrangement may vary from those in NAT1 and NAT2, contributing to different catalytic properties.

  • Substrate Binding Pocket: The architectural differences in the substrate binding pocket likely account for differential substrate specificities compared to the canonical NAT enzymes.

What expression systems are suitable for producing Recombinant Rat CML6?

While multiple expression systems exist for recombinant protein production, several considerations apply specifically to Recombinant Rat CML6:

  • Bacterial Expression: E. coli represents the predominant expression system for Recombinant Rat CML6 due to its simplicity, cost-effectiveness, and high yield potential . Strains optimized for recombinant protein expression such as BL21(DE3) are commonly employed to minimize proteolytic degradation and enhance protein folding.

  • Mammalian Expression: For studies requiring post-translational modifications that may be critical for certain functions, mammalian expression systems (CHO or HEK293 cells) offer advantages but with reduced yield compared to bacterial systems.

  • Baculovirus-Insect Cell Systems: This intermediate system provides moderate post-translational modification capability with higher yields than mammalian systems, making it suitable for functional studies of CML6.

  • Cell-Free Expression: For rapid prototyping or when the protein exhibits toxicity to host cells, cell-free expression systems can be employed, though scale-up limitations exist.

The selection criteria should be based on the research question being addressed, with E. coli remaining the standard for biochemical and structural studies.

What are optimal purification methods for Recombinant Rat CML6?

Purification of His-tagged Recombinant Rat CML6 typically follows a multi-step process:

  • Immobilized Metal Affinity Chromatography (IMAC): The primary purification step utilizes the affinity of the His-tag for Ni²⁺ or Co²⁺ ions immobilized on a matrix. A step gradient of imidazole (20-250 mM) effectively elutes the protein while minimizing non-specific binding.

  • Size Exclusion Chromatography (SEC): This secondary purification step separates potential aggregates and contaminating proteins based on molecular size, yielding highly pure monomeric protein.

  • Ion Exchange Chromatography (IEX): For applications requiring ultrahigh purity, a tertiary purification step using cation or anion exchange (depending on the protein's isoelectric point) can remove trace contaminants and degradation products.

  • Quality Control Assessment: Purity assessment should be performed using SDS-PAGE (≥95% purity standard), western blot confirmation, and mass spectrometry for molecular weight verification .

For Recombinant Rat CML6 specifically, addition of reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) throughout the purification process helps maintain cysteine residues in their reduced state, preserving enzymatic activity.

How can enzymatic activity of Recombinant Rat CML6 be assessed?

Activity assessment of Recombinant Rat CML6 can be performed using multiple complementary approaches:

  • Spectrophotometric Assays:

    • DTNB (Ellman's Reagent) Coupled Assay: Measures the release of CoA-SH during acetyl transfer by detecting the formation of TNB (λ = 412 nm).

    • Direct UV Absorption: Monitors the decrease in absorbance at 230 nm corresponding to the consumption of acetyl-CoA.

  • HPLC Analysis:

    • Separation and quantification of acetylated and non-acetylated substrates provide direct evidence of enzymatic activity.

    • Typical substrates include aromatic amines like 2-aminofluorene (2-AF) or 4-aminoazobenzene (AAB), similar to those used for other N-acetyltransferases .

  • Kinetic Parameters Determination:

    • For robust characterization, apparent Km and Vmax values should be determined using substrate concentrations spanning at least 0.2× to 5× the Km value.

    • Based on related N-acetyltransferases, substrate concentrations between 0.2-100 μM would likely be appropriate, with expected Km values potentially in the micromolar range .

  • Activity Verification Methods:

    • Positive control experiments using well-characterized N-acetyltransferases can validate assay conditions.

    • The use of specific inhibitors can confirm the specificity of the observed activity.

What storage conditions optimize stability of Recombinant Rat CML6?

Proper storage is crucial for maintaining the activity and structural integrity of Recombinant Rat CML6:

  • Short-term Storage (1-2 weeks):

    • 4°C in buffer containing 20-50 mM Tris-HCl or phosphate buffer (pH 7.4-8.0)

    • Addition of 10-20% glycerol to prevent freezing damage

    • Inclusion of 1-5 mM DTT or 2-10 mM β-mercaptoethanol to maintain reduced cysteines

  • Long-term Storage:

    • Aliquoting into polypropylene microtubes and freezing at -80°C is strongly recommended

    • For enhanced stability, the addition of carrier proteins such as bovine serum albumin (0.5-1.0 mg/mL) can prevent activity loss

    • Flash-freezing in liquid nitrogen before transferring to -80°C minimizes ice crystal formation

  • Freeze-Thaw Cycles:

    • Multiple freeze-thaw cycles should be strictly avoided

    • Upon initial thawing, the protein should be immediately aliquoted and refrozen

  • Stability Assessment:

    • Regular activity testing of stored samples should be conducted

    • SDS-PAGE analysis to monitor potential degradation

The choice of storage buffer components should be empirically determined as they may affect experimental outcomes, particularly when carrier proteins are employed .

How does substrate specificity of Recombinant Rat CML6 compare to NAT1 and NAT2?

Substrate specificity analysis reveals important functional distinctions between Recombinant Rat CML6 and the canonical N-acetyltransferases:

PropertyNAT1NAT2CML6 (Predicted)
Preferred Substratesp-aminobenzoic acid, p-aminosalicylic acidIsoniazid, hydralazine, sulfamethazinePotentially distinct from both NAT1 and NAT2
Km for 2-AF0.2-0.9 μM 22-32 μM Likely intermediate between NAT1 and NAT2
Km for AAB0.2-0.9 μM 62-138 μM Requires experimental determination
N,O-acyltransferase activityHigh (Km ~6 μM) Low (Km 120-420 μM) Unknown, requires experimental determination
Catalytic efficiency (kcat/Km)High for specific substratesLower but broader substrate rangeExpected to have specialized substrate profile

Unlike the well-characterized NAT1 and NAT2, which show distinct substrate preferences and kinetic parameters , the substrate specificity of CML6 remains less defined. Based on structural predictions and phylogenetic analysis, CML6 likely possesses a unique substrate profile that may encompass endogenous compounds not efficiently acetylated by NAT1 or NAT2.

Experimental approaches to delineate this specificity should include systematic screening with a diverse panel of potential substrates and comparative kinetic analysis.

What role might Recombinant Rat CML6 play in xenobiotic metabolism?

The potential roles of Recombinant Rat CML6 in xenobiotic metabolism can be examined from multiple perspectives:

  • Phase II Metabolism:

    • Like other N-acetyltransferases, CML6 likely participates in the biotransformation of aromatic amines and hydrazines

    • May contribute to the detoxification pathway for certain xenobiotics

    • Potentially catalyzes the activation of procarcinogens to their reactive metabolites

  • Tissue-Specific Expression:

    • Expression patterns distinct from NAT1 and NAT2 may indicate specialized metabolic functions in specific tissues

    • Differential expression across tissues could impact xenobiotic metabolism in a tissue-dependent manner

  • Species-Specific Metabolism:

    • Rat CML6 may metabolize compounds differently than homologous enzymes in other species

    • Could account for species-specific differences in xenobiotic metabolism observed in toxicological studies

  • Polymorphisms and Phenotypic Variation:

    • Genetic variants of CML6 might contribute to individual differences in metabolic capacity

    • Could affect susceptibility to certain toxicants or carcinogens

Understanding the specific role of CML6 requires comprehensive phenotyping studies comparing wild-type and CML6-deficient systems, along with detailed metabolite profiling.

How can molecular docking be utilized to predict substrates for Recombinant Rat CML6?

Molecular docking represents a powerful computational approach for predicting potential substrates and inhibitors of Recombinant Rat CML6:

  • Homology Model Development:

    • In the absence of a crystal structure, homology models can be generated using related N-acetyltransferases as templates

    • Multiple templates should be employed to enhance model accuracy, particularly for the active site region

    • Model validation through energy minimization and Ramachandran plot analysis is essential

  • Active Site Characterization:

    • Identification of the catalytic triad and substrate binding pocket

    • Calculation of electrostatic surface potentials to identify regions favorable for substrate binding

    • Mapping of conserved and variable regions compared to NAT1 and NAT2

  • Docking Protocol:

    • A two-step approach including:
      a) Blind docking to identify potential binding sites
      b) Focused docking at the identified sites with enhanced sampling

    • Both substrate and acetyl-CoA should be incorporated in the docking simulation

    • Scoring functions should prioritize interactions with catalytic residues

  • Validation and Refinement:

    • Correlation of docking scores with experimental binding affinities for known substrates

    • Molecular dynamics simulations to assess stability of docked complexes

    • Iterative refinement based on experimental feedback

This computational approach can guide experimental substrate screening efforts and provide structural insights into the unique functional properties of CML6.

How can low expression yields of Recombinant Rat CML6 be addressed?

Optimizing expression of Recombinant Rat CML6 requires systematic troubleshooting:

  • Expression Vector Optimization:

    • Codon optimization for E. coli (or chosen expression system)

    • Evaluation of different promoter strengths (T7, tac, araBAD)

    • Testing fusion partners to enhance solubility (MBP, SUMO, Thioredoxin)

    • Optimizing ribosome binding site efficiency

  • Culture Condition Modifications:

    • Temperature reduction (16-25°C) during induction to promote proper folding

    • Inducer concentration titration (IPTG: 0.1-1.0 mM)

    • Media composition adjustments (rich media like TB or autoinduction media)

    • Extended expression time with lower inducer concentrations

  • Host Strain Selection:

    • BL21(DE3) derivatives with enhanced features:

      • Rosetta: Supplies rare codons

      • Origami: Promotes disulfide bond formation

      • Arctic Express: Co-expresses cold-adapted chaperones

    • C41/C43 strains for potentially toxic proteins

  • Co-expression Strategies:

    • Chaperone co-expression (GroEL/GroES, DnaK/DnaJ)

    • Rare tRNA supplementation

    • Acetyl-CoA synthetase to enhance substrate availability

A systematic Design of Experiments (DoE) approach should be employed to efficiently identify optimal conditions across multiple variables simultaneously.

What are common artifacts in Recombinant Rat CML6 activity assays?

Awareness of potential artifacts is crucial for accurate activity measurements:

  • Substrate-Related Artifacts:

    • Spontaneous hydrolysis of acetyl-CoA leading to background signal

    • Substrate solubility issues causing precipitation and apparent activity loss

    • Inner filter effects with fluorescent substrates leading to signal quenching

  • Enzyme Preparation Issues:

    • His-tag interference with enzymatic activity

    • Partial denaturation during purification or storage

    • Oxidation of catalytic cysteine residues

    • Presence of contaminating acetyltransferases from the expression host

  • Buffer Component Interference:

    • Incompatibility of reducing agents with certain assay methods

    • Metal ion contamination affecting enzyme conformation

    • Carrier protein contribution to background signals

    • pH shifts during reaction affecting kinetic parameters

  • Validation Approaches:

    • Heat-inactivated enzyme controls

    • Known inhibitor controls

    • Multiple orthogonal activity assays

    • Careful baseline corrections and appropriate blanks

Rigorous experimental design with appropriate controls is essential for distinguishing true enzymatic activity from assay artifacts.

How should kinetic data for Recombinant Rat CML6 be analyzed?

Robust kinetic analysis requires consideration of several factors:

  • Model Selection:

    • Michaelis-Menten kinetics for simple substrate-enzyme interactions

    • Substrate inhibition models for complex behaviors

    • Allosteric models (Hill equation) if cooperativity is observed

    • Two-substrate ordered or random bi-bi mechanisms for N-acetyltransferases

  • Data Transformation and Fitting:

    • Non-linear regression as the primary approach

    • Avoid Lineweaver-Burk transformations due to error amplification

    • Global fitting for complex mechanisms

    • Bootstrapping or Monte Carlo approaches for error estimation

  • Statistical Considerations:

    • Outlier identification and treatment

    • Weighting schemes for heteroscedastic data

    • Confidence interval determination

    • Model comparison using AIC or F-test

  • Parameter Reporting:

    • Report both Km and kcat (not just ratio)

    • Include standard errors for all parameters

    • Specify experimental conditions (temperature, pH, buffer)

    • Provide representative data plots

Similar to other N-acetyltransferases, CML6 kinetic data should be collected across multiple substrate concentrations spanning from below 0.2× Km to above 5× Km for reliable parameter estimation .

How might CRISPR/Cas9 approaches advance understanding of CML6 function?

CRISPR/Cas9 technology offers powerful tools for investigating the physiological role of CML6:

  • Genetic Manipulation Strategies:

    • Complete knockout models to assess physiological functions

    • Knock-in of reporter genes to track tissue-specific expression

    • Introduction of specific mutations to evaluate structure-function relationships

    • Conditional knockout systems for temporal control of gene expression

  • Experimental Models:

    • Cell line models for biochemical pathway analysis

    • Primary cell cultures for tissue-specific functions

    • Whole-animal models for systemic effects

    • Organoid systems for intermediate complexity

  • Functional Readouts:

    • Metabolomic profiling to identify endogenous substrates

    • Transcriptomic analysis to identify compensatory mechanisms

    • Phenotypic screening for unexpected functions

    • Xenobiotic challenge experiments to assess metabolic capacity

  • Comparative Approaches:

    • Multi-species comparison of CML6 function

    • Parallel manipulation of NAT1, NAT2, and CML6 for comparative analysis

    • Evolutionary analysis of functional conservation

These approaches can address fundamental questions about the physiological significance of CML6 that biochemical studies alone cannot resolve.

What comparative approaches might reveal about CML6 evolution and function?

Evolutionary analysis can provide insights into the specialized functions of CML6:

  • Phylogenetic Analysis:

    • Construction of comprehensive phylogenetic trees including CML6, NAT1, NAT2, and related enzymes

    • Identification of conserved vs. rapidly evolving regions

    • Detection of positive selection signatures indicative of functional specialization

  • Structural Comparison:

    • Comparison of active site architecture across species

    • Identification of species-specific structural features

    • Correlation of structural differences with substrate preferences

  • Expression Pattern Analysis:

    • Comparison of tissue-specific expression across species

    • Developmental regulation patterns

    • Response to physiological and pathological stimuli

  • Functional Conservation:

    • Cross-species substrate preference analysis

    • Complementation studies in knockout models

    • Chimeric enzyme approaches to map functional domains

Comparative approaches may reveal whether CML6 serves a conserved function across species or has evolved species-specific roles, potentially explaining discrepancies in xenobiotic metabolism between rats and humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.