Recombinant Rat Probable palmitoyltransferase ZDHHC12 (Zdhhc12)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Biology

Zdhhc12’s enzymatic activity is integral to cellular processes, including:

  • Protein Membrane Anchoring: Palmitoylation facilitates membrane localization of proteins like claudin-3 (CLDN3) in ovarian cancer cells .

  • Mitochondrial Regulation: Modulates reactive oxygen species (ROS) homeostasis and mitochondrial oxidative metabolism, as observed in human ovarian cancer models .

  • Interactions with Depalmitoylases: Co-regulates lipidation with enzymes such as ABHD17B, which removes palmitate groups .

Recombinant Protein Applications

Recombinant Zdhhc12 is utilized in biochemical and structural studies to investigate palmitoylation mechanisms. Key applications include:

ApplicationMethodOutcome
Enzymatic AssaysIn vitro palmitoylation of substrate proteins (e.g., CLDN3) Identify palmitoylation sites and catalytic efficiency
Structural StudiesX-ray crystallography or cryo-EM with palmitoyl-CoA analogs Elucidate substrate-binding pockets and zinc finger architecture
Cancer ResearchModulation of Zdhhc12 activity in ovarian cancer cell models Sensitize cells to cisplatin via ROS-mediated mechanisms

Interaction Network and Functional Partners

Zdhhc12 interacts with proteins involved in lipid metabolism, redox regulation, and cytoskeletal organization. Key partners include:

PartnerFunctionInteraction Score
Zfp28Zinc finger transcription factor; potential co-regulator of lipidation 0.657
Zdhhc22Palmitoyltransferase; regulates KCNMA1 and CNN3 membrane localization 0.616
GphnMolybdopterin molybdenumtransferase; links lipid metabolism to cofactor biosynthesis 0.489
Abhd17bDepalmitoylase; counteracts Zdhhc12 activity to regulate protein turnover 0.422

Oncogenic Roles in Ovarian Cancer

  • ROS Dysregulation: Overexpression of Zdhhc12 correlates with elevated ROS pathways in human ovarian cancer, suggesting a role in chemoresistance .

  • Mitochondrial Dysfunction: Knockdown of Zdhhc12 increases ATP production and ROS levels, sensitizing cells to cisplatin .

Challenges and Future Directions

  • Limited Rat-Specific Data: Most biochemical studies rely on human ZDHHC12 orthologs. Rat Zdhhc12’s unique substrates and regulatory pathways remain underexplored.

  • Therapeutic Potential: Inhibiting Zdhhc12 may enhance cisplatin efficacy in ovarian cancer, but species-specific validation is needed .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly include your request in the order notes, and we will strive to accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributor for precise delivery estimations.
For your information, all our proteins are shipped standard with blue ice packs. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for a maximum of one week.
Reconstitution
We advise briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc12; Palmitoyltransferase ZDHHC12; DHHC domain-containing cysteine-rich protein 12; DHHC-12; Zinc finger DHHC domain-containing protein 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Zdhhc12
Target Protein Sequence
MALWPLLNSGMLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELFLPLTFLLLVLGSLLL YLAVSLMDPGYVTAQPQPQEEPKEEQTAMVPQAIPLRRCRYCLVLQPLRARHCRECRRCV RRYDHHCPWMENCVGERNHPLFVAYLALQLVVLLWGLYLAWSGLQFFQPWGLWLRSTGLL FTTFLLLSFFALVVSLLLASHLYLVARNTTTWEFISSHRIAYLRQRTSNPFDRGPTRNLA HFFCGWPSGPWETLWAEEEEEGSSQVV
Uniprot No.

Target Background

Function
Palmitoyltransferase is an enzyme that catalyzes the addition of palmitate to various protein substrates. This particular palmitoyltransferase, ZDHHC12, exhibits activity towards gephyrin/GPHN, regulating its clustering at synapses and its function in gamma-aminobutyric acid (GABA) receptor clustering. Consequently, it indirectly regulates GABAergic synaptic transmission.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ZDHHC12 in cellular processes?

ZDHHC12 functions as a palmitoyltransferase enzyme that catalyzes protein palmitoylation, a critical post-translational modification involving the addition of palmitate groups to specific proteins. This modification plays a key role in regulating protein localization, stability, and function within cells. Palmitoylation influences membrane association of proteins, protein-protein interactions, and signaling pathway regulation. ZDHHC12 specifically contributes to these processes by adding palmitate groups to target substrates, affecting their cellular distribution and activity .

The enzyme contains the characteristic DHHC (Asp-His-His-Cys) motif within its catalytic domain, which is essential for its palmitoyltransferase activity. Dysregulation of protein palmitoylation through altered ZDHHC12 function has been associated with various pathological conditions, including cancer, neurological disorders, and metabolic conditions, highlighting its biological significance .

How does ZDHHC12 expression vary across tissue types and disease states?

ZDHHC12 expression demonstrates notable variability across different tissues and disease conditions. In cancer contexts, particularly in high-grade serous ovarian cancer (HGSOC), analysis of The Cancer Genome Atlas (TCGA) data has revealed significantly elevated ZDHHC12 expression compared to normal tissue . Similarly, in glioblastoma, ZDHHC12 has been identified as upregulated and associated with unfavorable prognosis .

When investigating ZDHHC12 expression patterns, researchers should employ multiple methodologies including qRT-PCR for mRNA quantification, Western blotting for protein detection, and immunohistochemistry for tissue-specific localization. The expression pattern analysis should ideally be correlated with clinical parameters such as tumor grade, stage, and patient survival to establish clinical relevance.

Epigenetic regulation appears to be one mechanism controlling ZDHHC12 expression levels. For example, analysis of glioma datasets has demonstrated a moderate negative correlation (Spearman's ρ=-0.22, Pearson's r=-0.23) between ZDHHC12 methylation and mRNA expression, suggesting that hypomethylation may contribute to elevated ZDHHC12 expression in glioma .

What experimental models are most appropriate for studying rat ZDHHC12?

When selecting experimental models for studying rat ZDHHC12, researchers should consider the specific research question, disease context, and translational relevance. For in vitro studies, rat glioma cell lines (such as C6 or 9L) can be appropriate when studying ZDHHC12 in the context of brain tumors. For ovarian cancer research, researchers might need to establish primary cultures from rat ovarian tissue or use available rat ovarian cancer cell lines.

For more physiologically relevant studies, three-dimensional culture systems should be considered. Spheroid models, as demonstrated in studies with human HGSOC cell lines (SNU119 and OVSAHO), provide valuable insights into ZDHHC12 function in a more complex cellular organization context . These models better recapitulate the in vivo tumor microenvironment and can reveal functional aspects not observable in traditional 2D cultures.

For in vivo studies, rat xenograft models can be established by implanting cells with manipulated ZDHHC12 expression into immunocompromised rats. Additionally, patient-derived xenografts or organoid models derived from rat tissues can provide higher translational value for studying ZDHHC12 function in a complex physiological environment .

What are the most effective methods for detecting and quantifying ZDHHC12 protein expression?

For effective detection and quantification of ZDHHC12 protein expression, researchers should implement a multi-technique approach:

  • Western Blot Analysis: Using a validated anti-ZDHHC12 antibody, such as the rabbit polyclonal antibody described in the literature (PACO38154), at recommended dilutions of 1:500-1:2000. Ensure proper sample preparation with appropriate lysis buffers that effectively solubilize membrane proteins, as ZDHHC12 is a transmembrane protein .

  • Immunohistochemistry (IHC): For tissue sections, use validated antibodies at dilutions of 1:20-1:200. Appropriate antigen retrieval methods should be optimized based on tissue fixation protocols. IHC provides valuable information about spatial distribution of ZDHHC12 within tissues .

  • Immunofluorescence (IF): For cellular localization studies, IF with recommended antibody dilutions of 1:50-1:200 can visualize ZDHHC12 subcellular distribution. Co-staining with organelle markers can determine precise localization patterns .

  • ELISA: For quantitative analysis, ELISA can be performed with antibody dilutions of 1:2000-1:10000, allowing for more precise quantification of ZDHHC12 protein levels across multiple samples .

For optimal results, researchers should validate antibody specificity using positive and negative controls, including ZDHHC12 knockout or knockdown samples. Quantification should be performed using appropriate software and normalized to loading controls or housekeeping proteins.

How can researchers effectively knockdown or inhibit ZDHHC12 in experimental models?

Several approaches can be employed to effectively knockdown or inhibit ZDHHC12 in experimental models:

  • RNA Interference (RNAi): siRNA or shRNA targeting ZDHHC12 has been successfully used in multiple studies. In glioma research, shRNA2 demonstrated knockdown efficiency of more than 50%, as assessed by qRT-PCR . When designing RNAi experiments, multiple siRNA/shRNA sequences should be tested to identify those with optimal knockdown efficiency while minimizing off-target effects.

  • CRISPR-Cas9 Gene Editing: For permanent knockout models, CRISPR-Cas9 technology can be employed to create ZDHHC12-null cell lines. This approach requires careful guide RNA design targeting exonic regions of ZDHHC12, followed by rigorous validation of knockout efficiency at both genomic and protein levels.

  • Pharmacological Inhibition: General palmitoylation inhibitors like 2-bromopalmitate (2BP) can be used to inhibit ZDHHC12 activity, though these lack specificity. Studies have shown that treatment with 2BP significantly enhances cisplatin cytotoxicity in 2D and 3D spheroid models of HGSOC through ROS-mediated mechanisms .

  • Fatty Acid Synthase Inhibition: Since FASN is required for de novo palmitate synthesis, inhibitors like C75 can block protein palmitoylation. This approach has been demonstrated to augment cisplatin efficacy in ovarian cancer models .

  • Orthogonal Enzyme-Substrate Design: For more specific inhibition, researchers have developed strategies based on synthetic orthogonal substrates that are only compatible with engineered zDHHC enzymes . This approach allows for selective manipulation of ZDHHC12 activity without affecting other zDHHC family members.

Validation of ZDHHC12 inhibition should include assessment of both mRNA and protein levels, as well as functional assays to confirm reduced palmitoylation activity.

What functional assays are most informative for studying ZDHHC12's role in disease progression?

To comprehensively evaluate ZDHHC12's role in disease progression, researchers should implement a spectrum of functional assays:

  • Cell Proliferation and Viability Assays: CCK8 assays have demonstrated that ZDHHC12 silencing reduces growth capability in glioma cell lines (DBTRG and U251) at 72 hours . Similar approaches using MTT, BrdU incorporation, or real-time cell analysis systems can quantify growth effects following ZDHHC12 manipulation.

  • Migration and Invasion Assays: Transwell and wound healing assays have shown that ZDHHC12-silenced glioma cells exhibit significantly decreased transmembrane migration at 48 hours . These assays are crucial for assessing metastatic potential.

  • 3D Spheroid Models: ZDHHC12 knockdown combined with cisplatin treatment induces massive disintegration of tumor spheroids of ovarian cancer cells (SNU119 and OVSAHO) . Spheroid formation and growth assays provide more physiologically relevant insights into tumor growth characteristics.

  • ROS Measurement Assays: Flow cytometry using specific ROS indicators has revealed that ZDHHC12 knockdown significantly increases basal mitochondrial and cellular ROS levels in ovarian cancer cells . These assays are essential for studying ZDHHC12's role in redox regulation.

  • Mitochondrial Function Assays: Assessment using MitoTracker staining, ATP production assays, and oxygen consumption rate measurements can reveal ZDHHC12's impact on mitochondrial activity, which shows increased mitochondrial mass and function upon ZDHHC12 inhibition .

  • Patient-Derived Organoid Models: Evaluating treatment responses in ascites-derived organoid lines from cisplatin-resistant ovarian cancer provides clinically relevant insights. Studies have shown that combined use of siZDHHC12 and cisplatin significantly reduces tumor organoid growth, suggesting ZDHHC12 as a target for overcoming cisplatin resistance .

  • In Vivo Xenograft Models: ZDHHC12 inhibition has been shown to significantly augment the anti-tumor activity of cisplatin in ovarian cancer xenograft models, providing essential pre-clinical validation .

How does ZDHHC12 contribute to chemotherapy resistance in cancer?

ZDHHC12 plays a significant role in chemotherapy resistance, particularly in platinum-based treatment resistance in ovarian cancer. The mechanisms underlying this contribution are multi-faceted:

  • Regulation of Redox Balance: ZDHHC12 helps maintain redox homeostasis in cancer cells, protecting them from oxidative stress-induced death. Analysis of transcriptomic data has revealed a strong positive association between ZDHHC12 expression and ROS pathways among all ZDHHC enzymes . This regulation of ROS levels is critical for cancer cell survival under chemotherapy stress.

  • Mitochondrial Function Modulation: ZDHHC12 influences mitochondrial activity, which is integrally connected to cisplatin response. Inhibition of ZDHHC12 results in increased mitochondrial mass and activity, as evidenced by enhanced MitoTracker staining in immunofluorescence and flow cytometric analyses . This alteration in mitochondrial function sensitizes cancer cells to cisplatin.

  • ROS-Mediated Mechanisms: Combination treatment with siZDHHC12 and cisplatin significantly increases ROS levels in cancer cells. This effect is reversible with ROS scavengers like N-acetylcysteine (NAC), indicating that ZDHHC12 inhibition enhances cisplatin cytotoxicity through ROS-dependent mechanisms .

  • Higher Expression in Resistant Cells: Gene expression analysis has demonstrated significantly higher levels of ZDHHC12 in cisplatin-resistant ovarian cancer spheroids compared to sensitive ones, suggesting a direct association with resistance development .

  • Impact on Apoptotic Pathways: ZDHHC12 knockdown combined with cisplatin treatment leads to increased apoptosis in cancer cells, as measured by various apoptotic markers . This indicates that ZDHHC12 may protect cancer cells from chemotherapy-induced apoptotic cell death.

For researchers investigating ZDHHC12 in chemoresistance, experimental designs should include paired sensitive and resistant cell lines, dose-response studies with various chemotherapeutic agents, and mechanistic studies focusing on ROS regulation and mitochondrial function.

What is the relationship between ZDHHC12 expression and cancer prognosis?

The relationship between ZDHHC12 expression and cancer prognosis appears to be cancer-type specific, with current evidence supporting its role as a negative prognostic indicator:

  • Glioma Prognosis: Analysis of glioma datasets has identified ZDHHC12 as an unfavorable prognostic marker. Higher expression correlates with poorer patient outcomes, as demonstrated in Kaplan-Meier survival analyses from datasets including GSE4271 and GSE4412 .

  • Ovarian Cancer Significance: In high-grade serous ovarian cancer (HGSOC), TCGA data analysis has revealed significantly elevated ZDHHC12 expression compared to normal tissue . Though direct survival correlations weren't explicitly stated in the available search results, the functional role of ZDHHC12 in cisplatin resistance suggests potential prognostic value.

  • Pan-Cancer Analysis: Comprehensive analysis of ZDHHC12 across multiple cancer types has found it to be upregulated in several cancers and associated with unfavorable prognosis, indicating its broader relevance in cancer progression beyond specific tumor types .

  • Epigenetic Regulation and Prognosis: Correlation analysis between DNA methylation and ZDHHC12 expression has revealed that hypomethylation may contribute to increased ZDHHC12 expression in glioma, potentially affecting prognosis . This suggests epigenetic mechanisms as an additional layer in ZDHHC12's prognostic significance.

Researchers investigating ZDHHC12's prognostic value should consider multivariate analyses that account for clinical variables (age, tumor stage, etc.), molecular subtypes, and treatment regimens. Integration of ZDHHC12 expression with other molecular markers may improve prognostic models. Additionally, validation across multiple independent cohorts is essential to establish robust prognostic associations.

How does ZDHHC12 regulate mitochondrial function and ROS homeostasis in cancer cells?

ZDHHC12 plays a critical role in regulating mitochondrial function and ROS homeostasis in cancer cells through several interconnected mechanisms:

  • Mitochondrial Mass and Activity Regulation: ZDHHC12 inhibition results in increased mitochondrial staining as determined by immunofluorescence and flow cytometric analysis, indicating enhanced mitochondrial mass or activity. Confocal microscopy analysis has revealed higher intensity MitoTracker staining in 3D spheroids of siZDHHC12-transfected cells compared to control cells .

  • ATP Production Control: Inhibition of ZDHHC12 leads to increased ATP levels in cancer cells, suggesting that ZDHHC12 may normally suppress mitochondrial ATP production . This modification of energy metabolism may contribute to cancer cell survival strategies.

  • Oxidative Phosphorylation Pathway Influence: Gene set enrichment analysis (GSEA) has revealed significant negative correlation of ZDHHC12 expression with pathways involved in oxidative phosphorylation and mitochondrial function in ovarian cancer datasets . This indicates that ZDHHC12 may normally suppress these pathways.

  • Basal ROS Level Modulation: ZDHHC12 knockdown significantly increases basal mitochondrial and cellular ROS levels in cancer cells as determined by flow cytometry. Furthermore, ZDHHC12 knockdown exacerbates H₂O₂-induced ROS elevation, an effect that can be reversed with ROS scavengers like NAC .

  • Cisplatin-Induced ROS Regulation: Combination treatment with siZDHHC12 and cisplatin significantly increases ROS levels beyond either treatment alone. Confocal microscopy in 3D spheroids has corroborated these findings, revealing a much stronger ROS signal upon combined treatment .

For researchers studying these mechanisms, it's important to employ multiple complementary techniques including flow cytometry for ROS measurement, mitochondrial function assays (oxygen consumption rate, membrane potential), ATP quantification, and imaging-based approaches with specific mitochondrial and ROS indicators.

How can orthogonal enzyme-substrate design strategies be applied to ZDHHC12 research?

Orthogonal enzyme-substrate design strategies represent a sophisticated approach to study ZDHHC12-specific functions by overcoming the challenge of shared substrates and catalytic mechanisms among zDHHC family members:

  • Principle of Orthogonal Design: This strategy involves engineering orthogonal enzyme-substrate pairs where a synthetic fatty acyl CoA can be utilized selectively by a mutant ZDHHC12 enzyme but not by the wild-type or other zDHHC family members . This approach has been successfully applied to other enzyme families including protein kinases, methyltransferases, and acetyltransferases.

  • Structural Guidance for Design: High-resolution structural data, such as that available for human zDHHC20 with 2-bromopalmitate, reveals that the fatty acyl-binding cavity is formed by transmembrane helices . This structural information guides the design of synthetic fatty acyl CoA analogues and corresponding enzyme mutations.

  • Mutation Strategy: Based on structural analysis, researchers can identify cavity-lining residues that can be modulated to accommodate synthetic substrates. These engineered variants maintain catalytic activity but exhibit altered substrate specificity.

  • Sample Processing Optimization: When implementing this strategy, researchers should consider optimized sample preparation workflows to address challenges including:

    • Reduced solubility of palmitoylated proteins, which can be improved using detergents like dodecylphosphocholine (DPC)

    • Protection of thioester linkages by rapid processing (within 2 days) with minimal refreezing

    • Reduction of sample complexity through increased washing during enrichment processes

    • Filtering of identified proteins with sequence coverage <5% to increase statistical confidence

  • Applications in Substrate Identification: This approach enables selective labeling and identification of specific ZDHHC12 substrates, which can reveal both known substrates and new substrates not previously reported in the literature .

This methodological approach requires expertise in protein engineering, synthetic chemistry, and proteomic analysis, but offers unparalleled specificity for investigating ZDHHC12 function.

What emerging therapeutic strategies target ZDHHC12 in cancer treatment?

Several emerging therapeutic strategies targeting ZDHHC12 show promise for cancer treatment, particularly for enhancing conventional chemotherapy efficacy:

  • RNAi-Based Approaches: Small interfering RNA (siRNA) targeting ZDHHC12 has demonstrated significant potential in sensitizing cancer cells to chemotherapy. In ovarian cancer models, siZDHHC12 combined with cisplatin shows synergistic effects in reducing cell viability and increasing apoptosis . Similar approaches could be developed for clinical application using appropriate delivery systems.

  • General Palmitoylation Inhibitors: The broad-spectrum protein palmitoylation inhibitor 2-bromopalmitate (2BP) has shown efficacy in preclinical studies, significantly enhancing cisplatin cytotoxicity in both 2D and 3D spheroid models of high-grade serous ovarian cancer through ROS-mediated mechanisms . Though lacking specificity, this approach validates the therapeutic potential of targeting palmitoylation.

  • Indirect Targeting via FASN Inhibition: Fatty acid synthase (FASN) inhibitors like C75 block de novo palmitate synthesis and consequently protein palmitoylation. This approach has been shown to augment cisplatin efficacy in ovarian cancer models . FASN inhibitors are already in clinical development, potentially offering a more immediate translational pathway.

  • Selective ZDHHC12 Inhibitors: Development of specific small molecule inhibitors targeting ZDHHC12 represents a promising direction. The orthogonal enzyme-substrate design strategy provides valuable insights for rational drug design targeting the ZDHHC12 catalytic pocket .

  • Combination Therapies: The most promising approach may be combining ZDHHC12 inhibition with conventional chemotherapy or other targeted therapies. Preclinical evidence shows that ZDHHC12 inhibition significantly augments the anti-tumor activity of cisplatin in ovarian cancer xenograft models and in ascites-derived organoid lines of platinum-resistant ovarian cancer .

For researchers working on therapeutic development, testing in cisplatin-resistant models is particularly important, as ZDHHC12 expression is higher in resistant cancer cells and may represent a mechanism for overcoming treatment resistance .

What are the current technical challenges in studying ZDHHC12 substrates and function?

Researchers face several technical challenges when investigating ZDHHC12 substrates and function:

  • Shared Substrate Specificity: A fundamental challenge is that all zDHHC enzymes utilize palmitoyl CoA as a substrate and share a common catalytic mechanism, making it difficult to distinguish ZDHHC12-specific functions and substrates . This necessitates development of specialized approaches like orthogonal enzyme-substrate pairs.

  • Protein Solubility Issues: Palmitoylated proteins often exhibit reduced solubility, complicating their extraction and analysis. Specialized detergents like dodecylphosphocholine (DPC) are required to effectively solubilize membrane-associated palmitoylated proteins .

  • Thioester Linkage Instability: The thioester bond linking the palmitate to target proteins is relatively labile, requiring careful sample handling to prevent deacylation. Rapid processing (within 2 days) with minimal refreezing is recommended to protect these linkages .

  • Sample Complexity: Excessive sample complexity can result in non-specific enrichment during palmitoylation studies. Increasing wash steps during enrichment processes can help reduce this complexity and improve specificity .

  • Limited Structural Information: While structures exist for some DHHC family members, complete structural information specifically for ZDHHC12 remains limited, constraining structure-based approaches for studying function and developing inhibitors.

  • Off-Target Effects of Inhibitors: Current pharmacological inhibitors of protein palmitoylation like 2BP lack specificity for individual DHHC enzymes, complicating the interpretation of inhibitor studies .

  • Translating In Vitro Findings: Bridging the gap between in vitro observations and in vivo relevance remains challenging. While xenograft and organoid models provide valuable insights, further work is needed to fully validate ZDHHC12 as a therapeutic target .

Researchers addressing these challenges should consider integrated approaches combining genetic, biochemical, and computational methods to build a comprehensive understanding of ZDHHC12 function.

What are the most promising avenues for future ZDHHC12 research?

Several promising research avenues for ZDHHC12 investigation hold significant potential for advancing our understanding and clinical applications:

  • Comprehensive Substrate Identification: Utilizing advanced proteomic approaches combined with orthogonal enzyme-substrate design strategies to comprehensively identify ZDHHC12-specific substrates . This would provide critical insights into ZDHHC12's biological roles and potential downstream targets for therapeutic intervention.

  • Structural Biology Studies: Determining high-resolution structures of ZDHHC12 alone and in complex with substrates would enable structure-based drug design and provide mechanistic insights into ZDHHC12 function and regulation. Current structural information for related family members provides a foundation for this work .

  • Tissue-Specific Functions: Investigating ZDHHC12's role across different tissues and developmental stages would provide a more complete picture of its physiological functions. This could reveal context-dependent roles that might influence therapeutic strategies.

  • Development of Selective Inhibitors: Designing small molecule inhibitors with high selectivity for ZDHHC12 over other DHHC family members represents a critical step toward clinical translation. The orthogonal enzyme-substrate design approach provides valuable insights for rational inhibitor development .

  • Combination Therapy Optimization: Further exploration of ZDHHC12 inhibition in combination with various chemotherapeutic agents beyond cisplatin could identify additional synergistic treatment approaches for different cancer types .

  • Biomarker Development: Validating ZDHHC12 expression or activity as a predictive biomarker for treatment response, particularly in the context of platinum-based chemotherapy resistance in ovarian cancer .

  • In Vivo Models and Preclinical Studies: Developing and characterizing genetic models (such as conditional knockout mice) for ZDHHC12 would provide valuable insights into its physiological roles and potential side effects of inhibition. Further preclinical studies in patient-derived xenografts and organoid models would strengthen the case for clinical development of ZDHHC12-targeting therapies .

These research directions collectively hold promise for translating our growing understanding of ZDHHC12 biology into clinical advances, particularly in the context of cancer treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.