Recombinant Rat Probable palmitoyltransferase ZDHHC24 (Zdhhc24)

Shipped with Ice Packs
In Stock

Description

Functional Roles

ZDHHC24 facilitates S-palmitoylation, a reversible lipid modification that anchors proteins to membranes. Key biological roles include:

  • Membrane Protein Trafficking: Enhances stability and localization of transmembrane proteins .

  • Signal Transduction: Modulates signaling pathways by palmitoylating receptors or adaptor proteins .

  • Metabolic Regulation: Indirectly implicated in lipid metabolism through interactions with enzymes like IRHOM2 .

In rats, ZDHHC24 is expressed in tissues rich in secretory or membrane-bound proteins, such as the liver and brain .

Diagnostic Assays

  • ELISA Kits: Quantify endogenous ZDHHC24 in rat tissues (detection range: 0.156–10 ng/ml) .

  • Antibody Validation: Used as a positive control in Western blotting (e.g., Thermo Fisher PA5-53461) .

Mechanistic Studies

  • Enzyme Activity Assays: Measures palmitoyltransferase activity using radiolabeled palmitate .

  • Protein Interaction Mapping: Identifies substrates via co-immunoprecipitation .

Stability and Reconstitution

ParameterSpecification
Reconstitution0.1–1.0 mg/mL in sterile PBS or water
Buffer CompatibilityTris/PBS-based buffers with ≤6% trehalose
Shelf Life6 months at -80°C

Activity Validation

  • Catalyzes palmitoylation of synthetic peptides (e.g., IRHOM2-derived substrates) .

  • Inhibited by 2-bromopalmitate, a palmitoylation antagonist .

Comparative Analysis with Related Proteins

FeatureZDHHC24 (Rat)ZDHHC2 (Rat)ZDHHC3 (Human)
Gene IDZdhhc24 Zdhhc2 ZDHHC3
Amino Acid Length284 366 372
Key DomainDHHC (C157) DHHC (C156) DHHC (C159)
SubstratesIRHOM2 (hypothesized) SNAP-25 IRHOM2, TLR4
Disease LinkNASH (indirect) Cancer Metabolic syndrome

Challenges and Future Directions

  • Substrate Specificity: Limited data on endogenous substrates in rats .

  • Therapeutic Potential: Role in metabolic diseases like NASH warrants further study .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc24; Probable palmitoyltransferase ZDHHC24; Membrane-associated zinc finger protein DHHC25; Zinc finger DHHC domain-containing protein 24; DHHC-24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Zdhhc24
Target Protein Sequence
MGEPWAARGTEGAPARMPVVFTALWAAVVVLELTYVMVLGPGPPPLEPLARALQLALAAY QLLNLLGNMGLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRR DHHCRLLGRCVGFHNYRPFLCLLLHAAGVLLHISVLLSPALSALLQAHSALYTVALLLLP WLMLLTGKVSLAQFALAFVVDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGQHSYDLG MSHNLQAALGPRWALVWFWPFLASPLPGDGITFQTPTDVGLVTS
Uniprot No.

Target Background

Function
Probable palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the predicted membrane topology of rat ZDHHC24 compared to other ZDHHC family members?

Rat ZDHHC24, like its human ortholog, is predicted to have five transmembrane domains (TMDs), which differs from the typical four-TMD structure found in most zDHHC enzymes. According to structural analyses, the arrangement places the catalytic DHHC domain in a specific orientation relative to the membrane. For zDHHC4, another five-TMD enzyme, three TMDs precede the cytoplasmic DHHC-CRD (DHHC Cysteine-Rich Domain), whereas the topology of zDHHC24 appears to have a different arrangement that affects substrate accessibility and activity . When working with recombinant Zdhhc24, it's important to consider this unique topology when designing expression systems to ensure proper membrane insertion and folding.

How does the DHHC motif in rat ZDHHC24 contribute to its palmitoyl transferase activity?

The DHHC motif in rat ZDHHC24, like in other ZDHHC family members, is essential for its palmitoyl transferase activity through a two-stage catalytic mechanism. First, ZDHHC24 undergoes auto-S-palmitoylation at the conserved cysteine in the DHHC motif, forming a thioester intermediate with palmitoyl-CoA. Second, the palmitoyl group is transferred to a substrate protein cysteine that is proximal to the ZDHHC catalytic site . The catalytic activity of rat ZDHHC24 can be assessed using NBD-palmitoyl-CoA, which provides a fluorescent readout of auto-S-palmitoylation. Mutation of the critical cysteine in the DHHC motif to serine would abolish this activity, as demonstrated with other ZDHHC family members .

What are the key structural differences between recombinant rat ZDHHC24 and human ZDHHC24?

Recombinant rat ZDHHC24 and human ZDHHC24 share significant sequence homology but exhibit subtle structural differences that may affect their substrate specificity and regulation. The rat protein is typically produced with similar purity (≥85% as determined by SDS-PAGE) as the human version, but researchers should be aware of species-specific post-translational modifications and folding patterns. When designing experiments that cross species boundaries, it's essential to validate whether findings with the rat protein translate to human systems, particularly regarding substrate recognition domains outside the conserved DHHC motif.

What expression systems are most effective for producing functional recombinant rat ZDHHC24?

Multiple expression systems can be used for producing recombinant rat ZDHHC24, each with specific advantages:

Expression SystemAdvantagesConsiderationsTypical Yield
Cell-Free ExpressionRapid production, avoids toxicity issuesLimited post-translational modificationsTypically ≥85% purity by SDS-PAGE
E. coliHigh yield, cost-effectiveRequires optimization for membrane protein foldingVariable, requires refolding steps
BaculovirusBetter folding of mammalian proteinsMore time-consuming, higher costHigher functional activity
Mammalian CellNative-like post-translational modificationsLower yield, higher costHighest biological activity

For functional studies, mammalian or insect cell expression systems are preferable to ensure proper membrane insertion and post-translational modifications. Cell-free systems can be suitable for structural studies or antibody production where native conformation is less critical .

What purification strategies optimize the yield of active recombinant rat ZDHHC24?

Purifying active recombinant rat ZDHHC24 requires specialized approaches due to its membrane-embedded nature. A recommended purification workflow includes:

  • Gentle cell lysis using detergents that preserve protein structure (e.g., n-dodecyl β-D-maltoside or digitonin)

  • Membrane fraction enrichment via differential centrifugation (20,000 g for 15 min)

  • Affinity chromatography using the fusion tag (typically His-tag)

  • Size exclusion chromatography to remove aggregates

  • Activity verification using the NBD-palmitoyl-CoA assay

For highest activity retention, maintain detergent concentrations above critical micelle concentration throughout purification and consider addition of lipids (0.1-0.5 mg/mL) to stabilize the protein. Avoid freeze-thaw cycles as they significantly reduce activity; instead, store aliquots at -80°C after flash-freezing in liquid nitrogen .

How can I measure the auto-S-palmitoylation activity of recombinant rat ZDHHC24?

The auto-S-palmitoylation activity of recombinant rat ZDHHC24 can be measured using the NBD-palmitoyl-CoA fluorescence assay, which directly reflects its S-acyltransferase catalytic capacity. This method involves:

  • Express tagged ZDHHC24 in a suitable system (HEK293 cells recommended)

  • Isolate membrane fractions by sonication and centrifugation (20,000 g for 15 min)

  • Resuspend membranes in HN buffer (50 mM HEPES, 150 mM NaCl, pH 7.4)

  • Add NBD-palmitoyl-CoA (10-25 μM) and incubate at 37°C

  • Quench reaction with SDS sample buffer at designated time points

  • Separate proteins by SDS-PAGE and detect fluorescence by laser scanning

  • Normalize signals to protein expression by Western blotting

For ZDHHC24, which may have lower auto-palmitoylation activity, pretreatment with fatty acid-free BSA (1%) for 1 hour prior to harvesting can enhance signal-to-noise ratio . This assay provides a direct measure of the first step in the ZDHHC catalytic cycle.

What are the optimal buffer conditions for maintaining ZDHHC24 enzymatic activity?

Maintaining ZDHHC24 enzymatic activity requires careful optimization of buffer conditions:

Buffer ComponentRecommended RangeEffect on Activity
pH7.0-7.4Optimal activity at physiological pH
Salt (NaCl)150-200 mMMaintains protein stability while allowing substrate interaction
Detergent0.1-0.5% DDM or 0.5-1% CHAPSCritical for solubilization while preserving activity
Reducing agent1-5 mM DTT or TCEPPrevents oxidation of catalytic cysteine
Glycerol10-20%Enhances stability during storage
Protease inhibitors1X cocktailPrevents degradation

Temperature sensitivity is significant; activity decreases rapidly above 42°C. For long-term storage, lyophilization from a 0.2 μm filtered solution in PBS with addition of stabilizers such as trehalose is recommended, similar to protocols used for other recombinant proteins .

How does the activity of recombinant rat ZDHHC24 compare with other ZDHHC family members?

When comparing the activity of recombinant rat ZDHHC24 to other ZDHHC family members using standardized NBD-palmitoyl-CoA auto-S-palmitoylation assays, ZDHHC24 typically displays lower activity than many family members. In comparative studies across the ZDHHC family:

  • High activity members: ZDHHC2, ZDHHC3, ZDHHC7, ZDHHC15, ZDHHC20

  • Moderate activity members: ZDHHC5, ZDHHC11, ZDHHC17

  • Lower activity members: ZDHHC24, ZDHHC19, ZDHHC23

ZDHHC24 requires optimized detection conditions, including depletion of endogenous acyl-CoA, higher concentrations of NBD-palmitoyl-CoA (25 μM vs. standard 10 μM), and a clarification spin to reduce background noise . This relative activity profile should be considered when designing experiments to assess ZDHHC24-specific functions.

What methodologies are effective for identifying specific substrates of rat ZDHHC24?

Identifying specific substrates of rat ZDHHC24 requires complementary approaches:

  • Chemical-genetic system approach: Engineer ZDHHC24 "hole" mutants paired with "bumped" chemically tagged fatty acid probes that selectively label ZDHHC24 substrates . This approach has been successfully implemented for other ZDHHCs (3, 7, 11, 15, and 20) and could be adapted for ZDHHC24.

  • Proximity-dependent labeling: Fuse ZDHHC24 with BioID or APEX2 to biotinylate proximal proteins, followed by streptavidin pulldown and mass spectrometry identification.

  • Palmitoyl-proteomics comparative analysis: Compare palmitoylated proteomes between wild-type and ZDHHC24-knockout or overexpression systems using acyl-biotin exchange or metabolic labeling with clickable palmitate analogs.

  • In vitro validation assay: Confirm direct palmitoylation using purified ZDHHC24 and candidate substrates with NBD-palmitoyl-CoA, measuring fluorescence transfer to the substrate protein .

These approaches should be used in combination to establish confidence in substrate identification, as palmitoylation is often regulated by multiple ZDHHC enzymes.

How does substrate recruitment by ZDHHC24 differ from other ZDHHC family members?

Substrate recruitment by ZDHHC24 differs from other ZDHHC family members primarily due to its unique structural features and subcellular localization. Unlike ZDHHC13 and ZDHHC17 that utilize Ankyrin-repeat domains, or ZDHHC5, ZDHHC8, and ZDHHC14 that employ PDZ-binding motifs, ZDHHC24 lacks these recognized protein-protein interaction domains .

Key differences in ZDHHC24 substrate recruitment include:

  • The predicted five transmembrane domain topology creates a distinct spatial arrangement of the catalytic site relative to potential substrates

  • ZDHHC24 likely has a different subcellular localization pattern than plasma membrane-localized ZDHHCs (e.g., ZDHHC5, ZDHHC8) or Golgi-localized enzymes (e.g., ZDHHC3, ZDHHC7)

  • Substrate specificity may be determined more by colocalization in specific membrane microdomains rather than direct protein-protein interaction motifs

When studying ZDHHC24-specific substrates, researchers should consider these factors and analyze the subcellular localization of both the enzyme and potential substrates .

What is the current understanding of ZDHHC24's role in disease processes based on substrate palmitoylation?

The role of ZDHHC24 in disease processes is emerging through studies of its altered expression and genetic variants in various pathologies:

  • Cancer: Analysis of ZDHHC gene alterations in kidney renal clear cell carcinoma (KIRC) revealed that ZDHHC24 exhibits genetic alterations in approximately 0.2-11% of cases, with high mRNA expression being the most common alteration . The pattern differs from other ZDHHCs, suggesting a specialized role.

  • Kidney disease: Differential expression analysis shows ZDHHC24 expression changes in KIRC tissues compared to normal tissues, with potential implications for cancer progression through altered substrate palmitoylation .

  • Neurological disorders: Although less studied than other ZDHHCs in neurological contexts, the role of protein palmitoylation in synaptic function suggests potential involvement of ZDHHC24 in neuronal signaling pathways.

Research on ZDHHC24's disease relevance is still developing, and identification of its specific substrates will be crucial for understanding its pathophysiological significance. Current evidence suggests its effects may be context-dependent and tissue-specific .

How can recombinant rat ZDHHC24 be utilized in drug discovery research?

Recombinant rat ZDHHC24 can be strategically employed in drug discovery research through several approaches:

  • High-throughput screening platform: Develop fluorescence-based assays using NBD-palmitoyl-CoA to screen compound libraries for ZDHHC24 inhibitors or activators . This requires optimization of the assay for 384- or 1536-well plate formats and establishment of robust Z-factor values.

  • Structure-based drug design: Use purified recombinant ZDHHC24 for structural studies (X-ray crystallography or cryo-EM) to identify potential binding pockets for small molecules. The membrane protein nature makes this challenging but potentially valuable.

  • Substrate-specific intervention: Once specific ZDHHC24 substrates are identified, develop compounds that selectively disrupt the enzyme-substrate interaction rather than targeting the catalytic site.

  • Disease-relevant cell models: Implement ZDHHC24 activity assays in cellular disease models where palmitoylation may play a role, such as cancer cell lines with altered ZDHHC24 expression .

When designing such experiments, control for species differences if translating findings from rat to human systems, and include appropriate controls (catalytically inactive mutants) to confirm specificity.

What are the technical challenges in studying ZDHHC24 function in cellular models?

Studying ZDHHC24 function in cellular models presents several technical challenges:

  • Low endogenous expression: ZDHHC24 typically has lower expression than many other ZDHHC family members, making detection of endogenous protein difficult. Solution: Use sensitive detection methods or create stable cell lines with tagged ZDHHC24.

  • Functional redundancy: Multiple ZDHHC enzymes may palmitoylate the same substrates, obscuring ZDHHC24-specific effects. Solution: Employ CRISPR/Cas9 knockout of ZDHHC24 combined with palmitoyl-proteomics to identify specific substrates.

  • Membrane protein manipulation: As a multi-pass membrane protein, ZDHHC24 is challenging to work with in biochemical assays. Solution: Develop membrane-based assays rather than attempting to work with solubilized protein .

  • Specificity of activity assays: Distinguishing ZDHHC24 activity from other ZDHHCs in cellular extracts is difficult. Solution: Use the chemical-genetic approach with engineered ZDHHC24 "hole" mutants and orthogonal probes .

  • Temporal dynamics: Protein palmitoylation is dynamic and regulated by both ZDHHCs and depalmitoylating enzymes. Solution: Use pulse-chase experiments with metabolic labeling to capture turnover rates.

Addressing these challenges requires integrated approaches combining genetic, biochemical, and imaging techniques.

How can recombinant ZDHHC24 be used to study palmitoylation dynamics in neurological disorders?

Recombinant ZDHHC24 can be leveraged to study palmitoylation dynamics in neurological disorders through several methodological approaches:

  • Comparative enzymatic profiling: Assess ZDHHC24 activity using the NBD-palmitoyl-CoA assay in brain tissue or neuronal cultures from disease models versus controls. Changes in activity may indicate altered regulation in pathological states.

  • Substrate-specific analyses: Once ZDHHC24-specific neuronal substrates are identified, develop targeted assays to measure their palmitoylation status in disease conditions using acyl-biotin exchange or metabolic labeling approaches.

  • Rescue experiments: In neuronal cultures from disease models with altered palmitoylation, introduce wild-type or catalytically inactive recombinant ZDHHC24 to determine if restoring normal enzyme function rescues cellular phenotypes.

  • Interaction with disease-associated proteins: Investigate whether ZDHHC24 directly palmitoylates proteins implicated in neurological disorders (e.g., NMDA receptors, AMPARs, synaptic scaffolding proteins) using in vitro palmitoylation assays with purified components.

  • Pharmacological modulation: Use recombinant ZDHHC24 to screen for compounds that can normalize aberrant palmitoylation patterns observed in neurological disorders.

When designing these experiments, consider the temporal and spatial regulation of palmitoylation in neurons, which may require sophisticated imaging approaches with palmitoylation sensors .

What are common pitfalls when working with recombinant rat ZDHHC24 and how can they be addressed?

Working with recombinant rat ZDHHC24 presents several challenges that researchers commonly encounter:

Common PitfallUnderlying CauseSolution
Low expression yieldMembrane protein toxicityUse inducible expression systems; lower induction temperature (16-18°C); add stabilizing agents like glycerol (10%)
Loss of activity during purificationDetergent-induced denaturationScreen detergents systematically; use milder options like DDM or LMNG; include lipids during purification
Inconsistent auto-palmitoylation assay resultsVariable membrane preparationStandardize membrane isolation protocol; use clarification spin (900 g, 3 min) before main centrifugation (20,000 g, 15 min)
High background in substrate studiesNon-specific palmitoylationPretreat with fatty acid-free BSA (1%) for 1 hour; include appropriate negative controls (catalytically inactive mutant)
Aggregation during storageProtein instabilityLyophilize from a 0.2 μm filtered solution in PBS with trehalose; reconstitute at recommended concentration

Additionally, when working with ZDHHC24, which shows lower activity than some family members, extending incubation times with NBD-palmitoyl-CoA and increasing probe concentration to 25 μM can improve signal detection .

How should experimental conditions be modified when comparing rat ZDHHC24 with orthologs from other species?

When comparing rat ZDHHC24 with orthologs from other species (e.g., human, mouse), several experimental modifications are necessary:

  • Expression system standardization: Use the same expression system for all species variants to minimize system-specific effects. For cross-species comparisons, mammalian cell lines like HEK293 provide a neutral background .

  • Codon optimization: Adjust codon usage for optimal expression in the chosen system, particularly for less common species.

  • Buffer condition assessment: Test a matrix of buffer conditions as optimal conditions may vary between orthologs due to subtle sequence differences affecting protein stability.

  • Substrate panel validation: When assessing substrate specificity, include substrates from multiple species to identify conservation or divergence in recognition patterns.

  • Quantification normalization: For activity comparisons, normalize to protein expression levels determined by Western blotting, and consider calculating relative activities rather than absolute values.

  • Functional equivalence testing: For mechanistic studies, create chimeric proteins or point mutations to identify regions responsible for species-specific differences in activity or substrate recognition.

These modifications ensure that observed differences reflect genuine biological variation rather than technical artifacts .

What advanced techniques can enhance the detection of low-abundance ZDHHC24 substrates?

Detecting low-abundance ZDHHC24 substrates requires sophisticated approaches that amplify signals and reduce background:

  • Metabolic orthogonal labeling combined with click chemistry enrichment: Use alkyne-palmitate labeling followed by copper-catalyzed azide-alkyne cycloaddition (CuAAC) with azide-biotin and streptavidin enrichment, which provides higher sensitivity than traditional methods.

  • Enzyme-substrate proximity labeling: Fuse ZDHHC24 with enzyme promiscuous biotin ligase (BioID2 or TurboID) to label proximal proteins that may be transient substrates, followed by streptavidin pulldown and mass spectrometry.

  • Thermal shift profiling after palmitoylation: Measure changes in protein thermal stability upon palmitoylation, which can detect modifications even when only a small fraction of the protein is modified.

  • Chemical-genetic approach with selective inhibition: Use the "bump-hole" strategy with engineered ZDHHC24 and corresponding substrate labeling , combined with selective inhibition of other ZDHHCs to reduce background.

  • Palmitoyl-proteomics with isobaric tagging: Implement multiplexed quantitative proteomics using TMT or iTRAQ labeling to compare palmitoylated proteins across multiple conditions (wild-type, ZDHHC24 overexpression, knockout).

  • Super-resolution microscopy of palmitoylated proteins: Use click chemistry-compatible fluorescent probes combined with STORM or PALM microscopy to visualize palmitoylation events at the nanoscale.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.