Recombinant Rat Prokineticin receptor 1 (Prokr1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Characteristics

PROKR1 is a 7-transmembrane glycoprotein with extracellular domains that share 81% sequence identity with human PROKR1 . Key structural features include:

FeatureDetailsSource
Host OrganismsProduced in E. coli or HEK-293 cells for recombinant expression .
TagsHis-tag (for E. coli), Fc-tag (for HEK-293) .
Purity>97% (SDS-PAGE/Coomassie blue staining) .
Molecular Weight~40 kDa (predicted; varies by isoform and post-translational modifications).

Production and Purification Methods

Recombinant PROKR1 is synthesized via bacterial or mammalian expression systems, followed by affinity chromatography or tag-specific purification:

MethodDescriptionApplicationsSource
Bacterial ExpressionE. coli produces PROKR1 with His-tag for metal-affinity purification .Western blotting, SDS-PAGE .
Mammalian ExpressionHEK-293 cells yield PROKR1 with Fc-tag for enhanced solubility .Functional assays, signaling studies .

Functional Roles in Biological Systems

PROKR1 mediates signaling through G-proteins (Gq, Gi, Gs), activating pathways like MAPK, STAT, and AKT/mTOR . Key roles include:

Angiogenesis and Tissue Development

  • Luteal Function: In porcine corpora lutea, PROKR1 reduces apoptosis and promotes cell viability via AKT/mTOR pathways .

  • Placental Angiogenesis: Upregulates VEGF and CD31 to enhance placental villi angiogenesis, critical in fetal growth restriction (FGR) .

Pregnancy and Reproduction

  • Trophoblast Invasion: Enhances matrix metalloproteinase (MMP2/9) expression via ERK1/2 activation, aiding extravillous trophoblast (EVT) invasion .

  • Decidualization: Elevated in first-trimester decidua, regulating COX-2 and prostaglandin synthesis for implantation .

Disease Pathophysiology

  • Neuroblastoma: PROKR1 activation via PROK1 promotes tumor cell proliferation through AKT signaling .

  • Choriocarcinoma: Overexpression in placental and blood samples correlates with tumor progression .

Research Applications and Experimental Tools

Recombinant PROKR1 is utilized in diverse experimental contexts:

ApplicationTechniquesFindingsSource
Signaling Pathway StudiesWestern blotting (phospho-ERK1/2, AKT), inositol phosphate assays .PROK1-PROKR1 activates Gq-coupled pathways .
Cell Viability AssaysFITC-Annexin V/propidium iodide staining for apoptosis analysis .PROKR1 reduces luteal cell apoptosis .
Antibody DevelopmentPolyclonal/rabbit antibodies for IHC, IF, and ELISA .Detects PROKR1 in human, rat, and mouse tissues .

Luteal Function in Pregnancy

In porcine models, PROK1 binding to PROKR1:

  • Reduces Apoptosis: Inhibits luteal cell death via AKT/mTOR .

  • Enhances Angiogenesis: Upregulates VEGF mRNA, critical for luteal vascularization .

Trophoblast-Placental Interactions

  • FGR Placentas: Elevated PROKR1 expression compensates for placental vascular defects by increasing angiogenesis .

  • Choriocarcinoma: Antagonists targeting PROKR1/2 delay tumor progression in mouse models .

Hematopoiesis and Inflammation

  • Myeloid Cell Survival: PROK1-PROKR1 upregulates Mcl-1, protecting multiple myeloma cells from apoptosis .

  • Endometrial Decidualization: Regulates COX-2 and IL-6/IL-8 expression during implantation .

Challenges and Future Directions

While recombinant PROKR1 has advanced our understanding of prokineticin signaling, limitations include:

  • Species-Specific Variations: Rat PROKR1 differs from human in N-terminal sequences, necessitating cross-species validation .

  • Antagonist Development: PKRA7 (a pan-prokineticin receptor antagonist) shows promise in cancer research but requires further optimization for clinical use .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Prokr1; Gpr73; Pkr1; Prokineticin receptor 1; PK-R1; G-protein coupled receptor 73; G-protein coupled receptor ZAQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
METTVGTLGENTTNTFTDFFSARDGSGAETSPLPFTFSYGDYDMPSDEEEDVTNSRTFFA AKIVIGMALVGIMLVCGIGNFIFITALARYKKLRNLTNLLIANLAISDFLVAIVCCPFEM DYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTAA GLIFLVWSVSILIAIPAAYFTTETVLVIVESQEKIFCGQIWPVDQQFYYRSYFLLVFGLE FVGPVIAMTLCYARVSRELWFKAVPGFQTEQIRRRLRCRRRTVLGLVCVLSAYVLCWAPF YGFTIVRDFFPSVFVKEKHYLTAFYVVECIAMSNSMINTLCFVTVRNNTSKYLKRILRLQ WRASPSGSKASADLDLRTTGIPATEEVDCIRLK
Uniprot No.

Target Background

Function
Prokineticin receptor 1 (Prokr1) is a receptor for prokineticin 1. It exclusively couples to the Gq subclass of heterotrimeric G proteins. Activation triggers calcium mobilization, phosphoinositide turnover stimulation, and p44/p42 mitogen-activated protein kinase activation. Prokr1 may play a role in early pregnancy.
Gene References Into Functions
  1. This study indicates that Prokr1 sensitivity to nutritional status in male rats is established early in the neonatal period. PMID: 25153663
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed in peripheral tissues with the highest level in the spleen and moderate levels in the adipose tissues, thymus, lung, kidney, testis, uterus and small intestine.

Q&A

What is Prokineticin Receptor 1 (Prokr1) and what are its structural characteristics?

Prokineticin Receptor 1 (Prokr1), also known as PKR1, ZAQ, GPR73, GPR73a, or PK-R1, is a 7-transmembrane glycoprotein belonging to the G protein-coupled receptor (GPCR) family. It functions as a receptor for prokineticins 1 and 2, which are cysteine-rich peptides of 81-86 amino acids . The extracellular portions of human PKR1 share 81% amino acid identity with mouse PKR1 and 78% with human PKR2, with most non-identity occurring in the N-terminal sequences .

When designing experiments involving recombinant Prokr1, researchers should consider that the protein contains multiple transmembrane domains that are crucial for its function and stability in membrane preparations. For optimal expression of functional recombinant Prokr1, expression systems that support proper protein folding and post-translational modifications should be employed.

What are the primary ligands for Prokr1 and their binding characteristics?

Prokr1 responds primarily to two endogenous ligands: prokineticin-1 (PK1, also known as endocrine gland-derived vascular endothelial growth factor or EG-VEGF) and prokineticin-2 (PK2, also known as Bv8) . Both ligands possess a unique structural motif consisting of five disulfide bonds and a completely conserved N-terminal hexapeptide sequence that is essential for their biological activity .

Interestingly, orthologues of these ligands from other species, such as mamba intestinal toxin 1 (MIT1) from black mamba venom and Bv8 from amphibians (Bombina sp.), can also activate Prokr1 . In recombinant systems, PK1 and PK2 activate both PKR1 and PKR2 with similar potency, suggesting that the physiological specificity is determined by the spatial and temporal expression patterns of ligands and receptors rather than by differential binding affinities .

What tissues and cell types express significant levels of Prokr1?

Prokr1 expression has been documented in multiple tissues including:

  • Gastrointestinal tract smooth muscle

  • Endocrine glands

  • Testis and ovary

  • Placenta

  • Adrenal glands

  • Cardiovascular system

  • Dorsal root ganglion neurons

When planning experiments with tissue-specific models, researchers should note that Prokr1 expression patterns may vary between developmental stages and physiological states. RT-PCR, immunohistochemistry, or in situ hybridization are recommended methods for confirming expression in specific experimental systems before proceeding with functional studies.

What detection methods are available for quantifying Prokr1 expression in rat samples?

Several approaches are available for detecting and quantifying Prokr1:

Enzyme-Linked Immunosorbent Assay (ELISA):
Sandwich ELISA kits specifically designed for rat PKR1 are commercially available. These typically use pre-coated microplates with antibodies specific to rat PKR1 and offer detection ranges from 0.16-10 ng/mL with sensitivities around 0.1 ng/mL . The procedure involves:

  • Sample addition to pre-coated wells

  • Addition of biotinylated detection antibody

  • Incubation with Avidin-HRP conjugate

  • Colorimetric detection measured at 450 nm

ELISA standard curve data example:

Concentration (ng/mL)ODCorrected OD
10.002.4192.358
5.001.7341.673
2.501.0180.957
1.250.5110.450
0.630.2720.211
0.320.1490.088
0.160.1020.041

Immunohistochemistry:
Antibodies specific to PKR1/PROKR1 can be used for tissue localization studies. For example, immunohistochemistry on frozen sections has been successfully used to detect PROKR1 in cardiac tissue .

RT-qPCR:
For mRNA expression analysis, RT-qPCR with specific primers targeting rat Prokr1 provides a sensitive method for quantifying transcript levels across different tissues or experimental conditions.

What experimental protocols are optimal for assessing Prokr1 signaling pathways?

Given that Prokr1 activates multiple signaling pathways, researchers can employ several complementary assays:

Calcium Mobilization Assays:

  • Use fluorescent calcium indicators (Fluo-4, Fura-2) to measure intracellular calcium release upon ligand binding

  • This approach detects Gq-coupled signaling pathway activation

  • Control experiments with Gq inhibitors can confirm pathway specificity

MAPK Activation Assays:

  • Western blotting with phospho-specific antibodies to detect ERK1/2 phosphorylation

  • Treatment with pertussis toxin can determine Gi-dependency of the MAPK pathway

  • Time-course experiments (5-60 minutes post-stimulation) are recommended to capture peak activation

Akt Kinase Activation:

  • Measures phosphorylation at Ser473 following Prokr1 stimulation

  • Important for studying angiogenic and survival pathways

  • Can be detected by phospho-specific antibodies via Western blot or ELISA

Protein Kinase C Activation:

  • Particularly relevant for studies involving TRPV1 channel modulation in pain research

  • Can be measured using PKC translocation assays or phosphorylation-specific antibodies

For all signaling assays, dose-response curves using recombinant PK1 or PK2 (typically 1-100 nM) should be established to determine EC50 values in your specific experimental system.

What are the key considerations when using recombinant Prokr1 in overexpression systems?

When working with recombinant rat Prokr1:

  • Expression System Selection:

    • Mammalian expression systems (HEK293, CHO cells) are preferred for functional studies as they provide appropriate post-translational modifications

    • For structural studies requiring higher protein yields, insect cell systems can be considered with careful validation of functionality

  • Expression Verification:

    • Confirm expression using epitope tags (His, FLAG, etc.) or specific antibodies

    • Validate membrane localization using cell surface biotinylation or immunofluorescence

  • Functional Validation:

    • Test receptor functionality using calcium mobilization assays with known ligands

    • Compare signaling properties with endogenous receptor to ensure physiological relevance

  • Control Experiments:

    • Include mock-transfected cells as negative controls

    • Consider co-expression of relevant G proteins if studying specific signaling pathways

    • Use PKR1-selective antagonists like PKRA7 to confirm specificity of observed effects

How do PKR1 and PKR2 differ in their signaling properties and physiological roles?

Despite their high sequence homology (approximately 85% amino acid identity), PKR1 and PKR2 exhibit distinct physiological roles that researchers should consider when designing targeted experiments:

Physiological Roles:

  • PKR1: Predominantly involved in peripheral functions including:

    • Pain perception via sensory neurons (PKR1-knockout mice show impaired pain response to various stimuli)

    • Cardiovascular protection and angiogenesis

    • Gastrointestinal motility regulation

  • PKR2: More involved in central nervous system functions:

    • Regulation of circadian rhythms

    • Neuronal migration during development

    • Olfactory bulb morphogenesis

When conducting knockout studies or using receptor-specific pharmacological tools, researchers should carefully validate the specificity of their approach and consider potential compensatory mechanisms between the two receptors.

What is the role of Prokr1 in cardiovascular physiology and pathology?

PKR1 has emerged as an important regulator of cardiac function and angiogenesis:

Cardioprotective Effects:
Research has demonstrated that PKR1 activation promotes cardiomyocyte survival and angiogenesis . In experimental models, PKR1 signaling:

  • Activates Akt-dependent survival pathways in cardiomyocytes

  • Stimulates MAPK pathways leading to endothelial cell proliferation and migration

  • Promotes neovascularization in cardiac tissue following injury

Experimental Approaches:
For researchers investigating PKR1 in cardiovascular contexts, the following methodologies have proven valuable:

  • Cardiomyocyte-specific overexpression or knockout models

  • Ex vivo perfused heart preparations to assess functional parameters

  • Angiogenesis assays (tube formation, scratch wound) using cardiac endothelial cells

  • Assessment of cardiac remodeling following ischemia-reperfusion injury

When designing cardiovascular studies involving PKR1, researchers should consider both acute signaling effects and long-term transcriptional responses, as the receptor influences both immediate contractile function and adaptive remodeling processes.

How does Prokr1 contribute to nociception and what are the implications for pain research?

Prokr1 plays a significant role in nociception, with important implications for pain research:

Molecular Mechanisms:
PKR1 is expressed in dorsal root ganglion (DRG) neurons where it modulates pain signaling. Key mechanisms include:

  • Activation of transient receptor potential vanilloid 1 (TRPV1) channels through protein kinase C-dependent pathways

  • Sensitization of nociceptors to various stimuli including heat, mechanical pressure, and chemical irritants

  • Potentiation of inflammatory pain responses

Experimental Evidence:
PKR1-deficient mice exhibit impaired pain perception to various stimuli, including:

  • Reduced sensitivity to noxious heat

  • Decreased mechanical pain perception

  • Attenuated responses to capsaicin and acidic pH

These findings suggest that targeting PKR1 may represent a potential approach for developing novel analgesics. When designing pain-related experiments involving PKR1, researchers should incorporate multiple pain modalities and consider both acute and chronic pain models to comprehensively assess receptor function.

What approaches are recommended for screening potential Prokr1 modulators?

For researchers developing or studying modulators of Prokr1 function:

Primary Screening Assays:

  • Calcium Mobilization Assay:

    • High-throughput compatible

    • Can detect both agonists and antagonists

    • Use recombinant cell lines stably expressing rat Prokr1

  • Competitive Binding Assays:

    • Using radiolabeled or fluorescently labeled PK1/PK2

    • Allows direct assessment of binding site interactions

    • Can distinguish allosteric from orthosteric modulators

Secondary Validation Assays:

  • Functional Downstream Readouts:

    • ERK1/2 phosphorylation

    • Akt activation

    • cAMP accumulation (for Gi-coupled effects)

  • Selectivity Profiling:

    • Counter-screening against PKR2 to determine subtype selectivity

    • Screening against related GPCRs to assess off-target effects

Translational Validation:
For compounds showing promise in cellular assays, validation in relevant physiological systems is essential:

  • Ex vivo smooth muscle contractility (for GI effects)

  • Angiogenesis assays (for vascular effects)

  • Pain behavioral models (for nociceptive modulators)

A known antagonist, PKRA7, has been identified as a potent prokineticin receptor antagonist with antitumor properties and blood-brain barrier penetration capability . This compound can serve as a positive control in antagonist screening campaigns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.