Recombinant Rat Prokineticin receptor 2 (Prokr2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize the development of the specified tag.
Synonyms
Prokr2; Gpr73l1; Pkr2; Prokineticin receptor 2; PK-R2; G-protein coupled receptor 73-like 1; G-protein coupled receptor I5E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MGDQNGNTSFAPDLNPPQDHVSLLPLNYSYGDYDIPLDDDEDVTKTQTFFAAKIVIGVAL AGIMLVCGVGNFVFIAALARYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLS WEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKRMNYQTASFLIALVWMVS ILIAIPSAYFTTETILVIVKNQEKLFCGQIWPVDQQLYYKSYFLFVFGLEFVGPVVTMTL CYARISQELWFKAVPGFQTEQIRKRLRCRRKTVLLLMGILTAYVLCWAPFYGFTIVRDFF PTLVVKEKHYLTAFYVVECIAMSNSMINTICFVTVKNNTMKYFKKMLLLHWRPSHYGSKS SADLDLKTSGVPATEEVDCIRLK
Uniprot No.

Target Background

Function
Prokineticin receptor 2 is a receptor for prokineticin 2. It exclusively couples to the G(q) subclass of heteromeric G proteins. Activation triggers calcium mobilization, phosphoinositide turnover stimulation, and activation of p44/p42 mitogen-activated protein kinase.
Gene References Into Functions
  1. This study suggests an intrinsic PK2 neurotransmission and functionally distinct roles for PKR2-expressing neurons in the SCN. PMID: 16819985
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Abundantly expressed in the CNS and reproductive organs with the highest levels in the cerebrum, cerebellum, testis and ovary.

Q&A

What is Prokineticin Receptor 2 (Prokr2) and what are its primary physiological functions?

Prokineticin receptor 2 (Prokr2) is a G-protein-coupled receptor that binds to both PROK1 and PROK2 ligands. It plays crucial roles in multiple physiological systems:

  • Neural development: Essential for olfactory bulb formation and GnRH neuron migration during development .

  • Reproductive function: Critical for maintaining normal gonadotropin secretion and fertility; knockout mice exhibit hypogonadotropic hypogonadism .

  • Circadian regulation: Acts as a mediator of circadian outputs from the suprachiasmatic nucleus (SCN) .

  • Energy homeostasis: Involved in metabolic regulation and feeding behavior .

Prokr2 functions through multiple G-protein signaling pathways including Gαi/o, Gαq, and Gαs, which activate different downstream cascades: MAPK/ERK pathway, IP3/Ca2+ release pathway, and cAMP pathway, respectively .

How can I express recombinant rat Prokr2 for experimental studies?

Several expression systems have been successfully employed:

  • Baculovirus expression system: Effective for producing functional rat Prokr2 with FLAG epitope tags. This system was used to generate recombinant receptor that maintained binding capacity to both prorenin and renin with Kd values of 8.0 and 20 nM, respectively .

  • Mammalian expression systems: For functional studies, PROKR2 wild-type sequence can be cloned into mammalian expression vectors. Methodologically:

    • Design gene-specific primers for rat Prokr2 amplification

    • Clone the amplified sequence into expression vectors (e.g., pcDNA3.1)

    • Verify sequence integrity through sequencing

    • Transfect into mammalian cell lines (HEK293T cells are commonly used)

The full-length rat Prokr2 contains 384 amino acids and spans the membrane 7 times, consistent with its GPCR classification .

What functional assays are available to evaluate rat Prokr2 activity?

Multiple complementary assays can assess different aspects of Prokr2 signaling:

Calcium Mobilization Assay:

  • Transfect cells with wild-type or mutant Prokr2

  • Load cells with calcium-sensitive dyes (e.g., Fluo-4)

  • Measure fluorescence changes after ligand stimulation

  • Generates dose-response curves that quantify receptor activation

ERK Signaling Assays:

  • Egr1-luciferase assay: Transfect cells with Prokr2 constructs alongside luciferase reporters containing EGR1 binding sites

  • Western blot analysis: Measure phosphorylated ERK levels directly after stimulation with PROK2

Radioligand Binding Assays:

  • Use 125I-labeled mamba intestinal toxin 1 (MIT) which binds to both Prokr2 and Prokr1

  • In brain tissue, observed binding primarily represents Prokr2 due to low Prokr1 expression

These assays have been validated in multiple studies and provide complementary information about receptor functionality.

How do Prokr2 knockout models affect physiological function in rodents?

Prokr2 knockout models (Prokr2 Brdm1/Brdm1 or m/m) display multiple phenotypes:

Reproductive System:

  • Infertility due to hypogonadotropic hypogonadism

  • Defective GnRH neuron migration

Metabolic Parameters:

  • Significantly lower oxygen consumption (V̇o2) and carbon dioxide production (V̇co2) in both light and dark phases

  • Reduced food intake (particularly pronounced in females)

  • Predisposition to torpor (body temperature dropping below normal levels)

The detailed metabolic parameters from Prokr2 m/m mice compared to controls are shown in the table below:

ParameterMale +/+ or +/mMale m/mFemale +/+ or +/mFemale m/m
Body weight (g)36.8±2.727.9±2.329.2±3.525.8±0.8
V̇o2, dark phase (ml·kg0.75·h-1)1315±711107±411556±251994±18
V̇o2, light phase (ml·kg0.75·h-1)1319±581143±421310±1471064±21
Total food intake, dark (g/12h)3.00±0.222.10±0.292.68±0.342.28±0.37
Total food intake, light (g/12h)1.55±0.251.53±0.163.34±0.550.91±0.37

These findings demonstrate that Prokr2 is essential for normal energy homeostasis and feeding behavior in rodents .

How can I distinguish between Prokr1 and Prokr2 signaling in experimental systems?

Distinguishing between Prokr1 and Prokr2 signaling presents challenges due to their structural similarity (85% sequence identity) , but several approaches can help differentiate them:

Tissue-Specific Expression Analysis:

  • Prokr2 is predominantly expressed in the CNS (particularly in the suprachiasmatic nucleus, lateral septum, midline thalamic nuclei, amygdala, anterior hippocampus, and DMN)

  • Prokr1 expression is generally low in rodent brain

Knockout Models Comparison:

  • Compare phenotypes between Prokr1-/- and Prokr2-/- animals to attribute specific functions

  • Use conditional tissue-specific knockouts to further differentiate roles

Selective Pharmacological Tools:

  • While both receptors bind PROK1 and PROK2, differential binding affinities can be exploited

  • Mamba intestinal toxin 1 (MIT) binds both receptors but with different affinities

Receptor-Specific Antibodies:

  • Use validated antibodies for immunoprecipitation followed by mass spectrometry to identify receptor-specific interacting partners

A comparative interactome study revealed proteins that selectively interact with wild-type vs. mutant PROKR2, providing insight into differential signaling mechanisms .

What are the molecular mechanisms underlying trafficking defects in mutant Prokr2?

Trafficking defects represent a common pathogenic mechanism for PROKR2 mutations. Advanced research has revealed:

ER-Golgi Cycling of Mutant Receptors:

  • Mutant PROKR2 (such as P290S) cycles between the endoplasmic reticulum (ER) and Golgi instead of proceeding to the cell surface

  • This post-ER quality control differs from typical ERAD (ER-associated degradation)

Comparative Interactome Analysis:
Proteins selectively interacting with wild-type or mutant PROKR2 provide mechanistic insights:

  • 53 proteins interact exclusively with wild-type PROKR2

  • 67 proteins interact exclusively with mutant P290S PROKR2

  • 171 proteins are enriched in wild-type PROKR2 interactome

  • 215 proteins are enriched in P290S PROKR2 interactome

ER Stress Response:

  • Mutant P290S PROKR2 shows higher association with BiP (an ER chaperone)

  • Enhanced ER localization of mutant PROKR2 increases ER stress

  • The IRE1 pathway appears involved in this stress response

Post-ER Quality Control:

  • Both wild-type and mutant PROKR2 exit the ER

  • Final fate is determined at the Golgi level: wild-type proceeds to the cell surface while mutants are retrieved to the ER

  • This represents an additional quality control system when traditional ER-based mechanisms fail to distinguish properly folded from misfolded proteins

These mechanisms explain why surface biotinylation assays detect wild-type but not mutant forms of PROKR2, providing important insights for therapeutic approaches targeting trafficking defects.

How can I categorize and functionally assess Prokr2 mutations identified in human disease?

Functional characterization of PROKR2 mutations requires systematic approaches:

Standardized Functional Classification System:
Based on Gαq pathway functionality, mutations can be classified into:

  • Neutral (N): >80% of wild-type activity

  • Low pathogenicity (L): 50-80% activity

  • Medium pathogenicity (M): 20-50% activity

  • High pathogenicity (H): <20% activity

Comprehensive Mutagenesis Protocol:

  • Design site-directed mutagenesis primers for your mutation of interest

  • Perform PCR-based mutagenesis using wild-type Prokr2 as template

  • Digest with DpnI to remove template DNA

  • Transform into competent bacterial cells

  • Verify mutation by colony PCR and sequencing

  • Prepare plasmid DNA (maxiprep)

  • Transfect into mammalian cells for functional analysis

Functional Assessment Methods:

  • Surface expression analysis: Biotinylation assays or immunofluorescence

  • Ligand binding assays: Measure binding affinity and capacity

  • Signaling capacity: Measure calcium mobilization, ERK phosphorylation, and cAMP production

  • Cellular localization: Co-localization with ER, Golgi, and plasma membrane markers

Genotype-Phenotype Correlation:
Examination of 310 Chinese IHH patients found PROKR2 to be the most frequently mutated gene (11.94%), with mutations classified according to their functional impact. Mutations located in transmembrane regions are more accurately predicted by Sorting Intolerant from Tolerant algorithms, while mutations in intracellular and extracellular domains are better predicted by Combined Annotation Dependent Depletion tools .

How does the Prokr2/Prok2 signaling axis integrate circadian rhythm control with energy homeostasis?

The integration of circadian and metabolic functions through Prokr2 signaling represents a complex research area:

Mechanistic Integration:

  • Prokr2 mediates circadian outputs from the SCN rather than affecting core clock function

  • Prokr2 knockout mice maintain entrainment to light-dark cycles but show disrupted circadian behavior

  • These mice also exhibit predisposition to torpor and altered metabolic parameters

Key Experimental Approaches:

  • Comprehensive metabolic phenotyping:

    • Measure oxygen consumption, carbon dioxide production, and respiratory quotient

    • Monitor feeding patterns (meal size, frequency, timing)

    • Record locomotor activity across light/dark cycles

    • Assess temperature regulation with implantable telemetry devices

  • Brain region-specific studies:

    • Targeted delivery of Prokr2 or antagonists to specific hypothalamic nuclei

    • Ex vivo hypothalamic explant studies measuring neuropeptide release

    • Electrophysiological recording of neuronal responses to Prok2 in SCN vs. arcuate nucleus

  • Combined genetic approaches:

    • Analyze double knockout models (e.g., Prokr2 with clock genes)

    • Use tissue-specific conditional knockouts to separate CNS effects

Research Findings:

  • Central administration of Prok2 inhibits food intake, potentially via activation of proopiomelanocortin (POMC) neurons in arcuate nucleus

  • Prok2 increases release of α-melanocyte-stimulating hormone (α-MSH) from hypothalamic explants

  • The anorexigenic effects of Prok2 are blocked by co-administration of agouti-related peptide (an α-MSH antagonist)

  • Fasting reduces hypothalamic Prok2 expression

These findings suggest Prok2/Prokr2 signaling represents a potential integration point for circadian rhythm and energy homeostasis, with possible therapeutic implications for metabolic disorders.

What approaches can resolve contradictions in Prokr2 inheritance patterns observed in human disease?

The inheritance patterns of PROKR2-related disorders show apparent contradictions that require sophisticated research approaches:

Observed Inheritance Pattern Discrepancies:

  • Majority of patients have heterozygous PROKR2 variants (~90%)

  • Homozygous variants represent approximately 7% of cases

  • Compound heterozygous inheritance is seen in ~3% of cases

  • Some variants cause disease only in homozygous form but are asymptomatic in heterozygous carriers

  • Other variants appear to cause disease in heterozygous state

Research Approaches to Resolve These Contradictions:

  • Digenic/Oligogenic Analysis:

    • Up to 20% of patients with PROKR2 mutations also carry mutations in other genes

    • Screen patients for mutations in all known IHH/KS genes

    • Perform whole exome/genome sequencing to identify novel modifier genes

    • Develop polygenic risk scores for disease prediction

  • Genetic Compensation Investigation:

    • Examine whether nonsense-mediated decay (NMD) of mutant transcripts triggers compensatory mechanisms

    • Investigate potential compensation by PROKR1 expression

    • Analyze expression of other genes in relevant signaling pathways

  • Functional Characterization of Variant Combinations:

    • Test combinations of PROKR2 variants with other gene variants in cellular models

    • Assess additive or synergistic effects on signaling pathways

    • Develop animal models with corresponding human mutations in multiple genes

  • Extended Haplotype Analysis:

    • Examine whether variants occur on specific haplotypes that may contain other regulatory variations

    • A study of 23 probands carrying the PROKR2 L173R mutation found a shared core haplotype of ~123 kb, suggesting an ancient founder mutation

These approaches can help explain variable disease penetrance and seemingly contradictory inheritance patterns, with significant implications for genetic counseling of affected families.

What are the current methodologies for designing therapeutic approaches targeting Prokr2?

Developing therapeutic strategies requires understanding of both Prokr2 function and dysfunction:

Targeting Trafficking Defects:

  • Identify small molecules that promote proper folding of mutant receptors

  • Design pharmacological chaperones that stabilize transmembrane domains

  • Modify the ERAD pathway to allow more mutant receptors to escape degradation

  • Consider gene therapy approaches for null mutations

Ligand Development:

  • Synthesize PROK2 analogs with improved stability and pharmacokinetics

  • Design biased agonists that selectively activate beneficial signaling pathways

  • Develop antagonists for conditions with excessive PROKR2 signaling

  • Consider the rare case of gain-of-function mutations in central precocious puberty

Experimental Validation:

  • Test chronic peripheral administration of PK2 to assess body weight reduction

    • Studies in both lean and obese mice showed PK2 administration reduced food intake and body weight

  • Evaluate central (ICV) administration for more targeted effects

  • Perform dose-response studies to determine therapeutic windows

  • Address potential side effects on reproduction and circadian rhythm

In Vivo Assessment:

  • Use rat Prokineticin-2 (Prok2) ELISA kits to measure endogenous levels

  • The detection range for such assays is typically 78-5000 pg/mL with sensitivity around 39.1 pg/mL

  • Monitor both on-target effects and potential off-target effects in other systems where Prokr2 functions

These methodological approaches provide a framework for developing targeted therapeutics for conditions associated with PROKR2 dysfunction, particularly metabolic disorders and neuroendocrine conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.