Recombinant Rat Proline-rich membrane anchor 1 (Prima1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Proline-rich Membrane Anchor 1 (PRIMA1)

Recombinant Rat PRIMA1 is a synthetic version of the naturally occurring PRIMA1 protein, produced through biotechnological methods. Its primary biological function is to facilitate the anchoring of acetylcholinesterase (AChE) tetramers to neural cell membranes, ensuring proper neurotransmission . The recombinant form is engineered for research applications, often incorporating tags (e.g., His-tag) to enable purification and structural studies.

Functional Mechanism

PRIMA1 assembles AChE T subunits into tetramers (G₄ form) via hydrophobic interactions with the t-peptide . This interaction is essential for:

  • Membrane Anchoring: Preventing AChE from diffusing away from synaptic clefts.

  • Enzymatic Activity: Glycosylation of AChE T subunits (not PRIMA1) enhances catalytic efficiency but does not affect oligomerization .

Expression Systems

PRIMA1 is produced in two primary systems:

ParameterMammalian Cells Yeast
Purity>80%>90%
TagHis-tagHis-tag
FormLiquid/lyophilized powderLyophilized
Endotoxin Level<1.0 EU/μgNot specified
Storage BufferPBSTris-based + 50% glycerol

Key Properties

  • Protein Stability: Requires storage at +4°C (short-term) or -20°C to -80°C (long-term) .

  • Post-Translational Modifications: Recombinant PRIMA1 retains proline-rich domains but lacks AChE glycosylation .

Role in AChE Anchoring

PRIMA1-mediated AChE tetramerization is critical for synaptic function. Without PRIMA1, AChE exists as monomers (G₁) or dimers (G₂), lacking membrane anchoring .

ParameterWith PRIMA1Without PRIMA1
OligomerizationTetramers (G₄)Monomers/Dimers (G₁/G₂)
Membrane LocalizationYesNo
ActivityHigh (glycosylated AChE T)Low (unglycosylated AChE T)

Glycosylation Effects

While PRIMA1 itself is not glycosylated, it stabilizes glycosylated AChE T subunits. Deletion of N-glycosylation sites in AChE T reduces enzymatic activity and disrupts trafficking to the Golgi/plasma membrane .

Comparative Analysis of Production Systems

CriteriumMammalian Cells Yeast
CostHighLow
GlycosylationComplexLimited
YieldModerateHigh
Tagging EfficiencyHigh (His-tag)High (His-tag)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Prima1; Proline-rich membrane anchor 1; PRiMA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-153
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Prima1
Target Protein Sequence
EPQKSCSKVTDSCQHICQCRPPPPLPPPPPPPPPPRLLSAPAPNSTSCPAEDSWWSGLVIIVAVVCASLVFLTVLVIICYKAIKRKPLRKDENGASVAEYPMSSSPSNKGVDVNAAVV
Uniprot No.

Target Background

Function
Prima1 plays a crucial role in anchoring acetylcholinesterase (ACHE) to the basal lamina of the neuromuscular junction and the membrane of neuronal synapses in the brain. It also organizes ACHE into tetramers.
Gene References Into Functions
  1. PRiMA in neurons contributes to the targeting of acetylcholinesterase to membrane rafts PMID: 20147288
  2. Research suggests that a MAP kinase signaling pathway acts as one of the transcriptional regulators in controlling PRiMA gene expression during neuronal differentiation. PMID: 19368807
Database Links

KEGG: rno:690195

UniGene: Rn.152596

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction. Cell junction, synapse. Note=In the brain, PRIMA linked to ACHE is found in membrane rafts.
Tissue Specificity
Isoforms 1 and 2 are expressed in the adult brain. In matured cortical neurons, only isoform 1 is detectable.

Q&A

What is the molecular function of Rat Prima1 in neural tissues?

Rat Prima1 (also known as PRiMA or Prima1l) functions primarily as a membrane anchor protein in neural tissues. It serves as an acetylcholinesterase membrane anchor precursor that helps localize acetylcholinesterase to specific cellular compartments . The protein contains proline-rich regions that facilitate protein-protein interactions, particularly in neural membranes. Prima1's anchoring function is critical for proper synaptic transmission and neuronal communication. While not directly comparable to ProSAP1 described in the literature, Prima1 shares the characteristic of being a proline-rich protein involved in neural function .

What expression systems are available for producing Recombinant Rat Prima1?

Recombinant Rat Prima1 can be expressed using several different host systems, each with distinct advantages:

  • E. coli expression: Offers high yield and cost-effectiveness but may present challenges with proper folding of membrane proteins

  • Yeast expression: Provides eukaryotic post-translational modifications while maintaining relatively high yield

  • Baculovirus expression: Offers insect cell-based expression with more complex eukaryotic modifications

  • Mammalian cell expression: Provides the most physiologically relevant modifications but at lower yields

The choice depends on the specific research application, with highly purified preparations (≥85% as determined by SDS-PAGE) available from each system .

What purification methods are most effective for Recombinant Rat Prima1?

Purification of Recombinant Rat Prima1 typically involves:

  • Initial extraction with appropriate detergents to solubilize the membrane-associated protein

  • Affinity chromatography using tagged recombinant constructs (His-tag or GST-tag)

  • Size exclusion chromatography to separate Prima1 from other proteins

  • Ion-exchange chromatography for further purification

  • Quality assessment using SDS-PAGE to confirm ≥85% purity

Similar to approaches used for other membrane-associated proteins, these methods can be adapted based on specific experimental needs and expression systems.

How can Prima1 expression be detected in rat brain tissues?

Detection of Prima1 in rat brain tissues can be accomplished through several methods:

  • Immunohistochemistry using specific antibodies against Prima1

  • Western blotting for protein expression analysis

  • ELISA for quantitative measurement

  • RT-PCR or qPCR for mRNA expression analysis

  • In situ hybridization to detect Prima1 transcripts in specific brain regions

These approaches can be adapted from methods used for similar proteins like ProSAP1, which employs techniques such as peroxidase-anti-peroxidase methods with DAB visualization and electron microscopy for detailed localization studies .

What are the critical experimental considerations when working with Recombinant Rat Prima1 in functional assays?

When designing functional assays with Recombinant Rat Prima1, researchers should consider:

  • Protein stability: Prima1 requires specific buffer conditions to maintain stability

  • Detergent selection: Critical for solubilizing the membrane protein while preserving function

  • Reconstitution approaches: For functional studies, Prima1 may need reconstitution into liposomes or nanodiscs

  • Binding partner presence: Some functional assays may require co-expression with interacting partners

  • Post-translational modifications: Depending on the expression system, modifications important for function may be present or absent

Similar to approaches used with other membrane proteins, careful consideration of these factors will help ensure reliable and reproducible results in functional studies.

How do Prima1 knockout models affect cholinergic function in the rat nervous system?

Prima1 knockout models in rats demonstrate several important phenotypes related to cholinergic system function:

  • Altered acetylcholinesterase localization at synaptic membranes

  • Modified neurotransmitter clearance kinetics at cholinergic synapses

  • Changes in cholinergic signaling efficiency

  • Potential compensatory mechanisms through related anchor proteins

  • Behavioral changes associated with cholinergic function

These models can be studied using techniques similar to those employed for other synaptic proteins, including electrophysiology, behavioral assays, and molecular analyses.

What protein-protein interactions are crucial for Prima1 function in neurons?

Key protein-protein interactions for Prima1 include:

  • Association with acetylcholinesterase through specific binding domains

  • Interactions with membrane lipids via hydrophobic regions

  • Potential interactions with cytoskeletal elements for localization

  • Association with other membrane proteins in functional complexes

  • Possible interactions with trafficking machinery for proper localization

Similar to research on ProSAP1, which interacts with the actin-binding protein cortactin through its proline-rich SH3 binding motif, Prima1 interactions can be studied using co-immunoprecipitation, yeast two-hybrid, and proximity labeling approaches .

What are the optimal conditions for preserving Prima1 activity during experimental procedures?

Preserving Prima1 activity requires attention to several critical factors:

  • Temperature control: Maintain samples at 4°C during purification and avoid freeze-thaw cycles

  • Buffer optimization: pH 7.2-7.4 with appropriate ionic strength

  • Protease inhibitor inclusion: To prevent degradation during extraction and purification

  • Reducing agent presence: To maintain cysteine residues in reduced state

  • Appropriate detergent selection: Critical for solubilizing membrane proteins while preserving structure

These conditions can be determined through activity assays and stability studies, similar to approaches used for other membrane-associated proteins.

How can researchers differentiate between Prima1 isoforms in experimental samples?

Differentiating Prima1 isoforms requires specialized approaches:

  • Western blot analysis with isoform-specific antibodies

  • RT-PCR with primers designed to detect specific splice variants

  • Mass spectrometry for precise identification of protein variants

  • 2D gel electrophoresis to separate isoforms based on both size and charge

  • Immunoprecipitation with isoform-specific antibodies followed by proteomic analysis

This approach is similar to the detection of alternatively spliced transcripts in ProSAP1, where specific oligonucleotide probes were designed to detect the presence or absence of specific insertions .

What approaches are most effective for studying Prima1 localization in neural membranes?

Effective approaches for studying Prima1 localization include:

  • Confocal microscopy with fluorescently labeled antibodies

  • Electron microscopy for ultrastructural localization

  • Subcellular fractionation followed by Western blotting

  • Live-cell imaging with tagged Prima1 constructs

  • Super-resolution microscopy for detailed membrane localization

These methods parallel approaches used for studying synaptic proteins like ProSAP1, which employed both confocal microscopy and immunoelectron microscopy to reveal localization at postsynaptic densities in hippocampal excitatory synapses .

How does Prima1 expression change during developmental stages in the rat brain?

Prima1 expression during rat brain development follows specific patterns:

  • Initial expression during early neural development

  • Upregulation during periods of synaptogenesis

  • Region-specific expression patterns that emerge during development

  • Potential alternative splicing regulation during different developmental stages

  • Correlation with the maturation of cholinergic systems

This developmental regulation resembles that of other synaptic proteins like ProSAP1, which shows strong upregulation during the period of synapse formation in the brain and differential regulation of splice variants during development .

What are the comparative differences between rat, mouse, and human Prima1 orthologs?

Key differences between rat, mouse, and human Prima1 include:

  • Sequence variations: While conserved in key functional domains, species-specific differences exist

  • Rat Prima1l vs. mouse BB120497/B230212M13Rik vs. human PRIMA1 gene nomenclature

  • Potential differences in tissue-specific expression patterns

  • Species-specific alternative splicing

  • Subtle functional differences that may affect experimental interpretation when translating between animal models and human applications

Understanding these differences is essential when designing experiments and interpreting results across different model systems.

What are the most effective siRNA designs for Prima1 knockdown studies?

For effective Prima1 knockdown studies:

  • Design siRNAs targeting conserved regions of Prima1 mRNA

  • Ensure >97% purity of synthetic siRNA preparations

  • Validate knockdown efficiency using RT-qPCR and Western blotting

  • Include appropriate controls (scrambled siRNA, non-targeting controls)

  • Optimize transfection conditions for neural cell types of interest

Commercial Prima1 siRNAs with validated efficiency are available for rat-specific knockdown studies and can be used as reference points for custom designs .

How can researchers quantify Prima1 levels in rat brain samples?

Quantification of Prima1 in rat brain samples can be accomplished through:

  • ELISA assays specifically designed for Rat Prima1 detection

  • Western blotting with densitometry analysis

  • Mass spectrometry-based quantitative proteomics

  • qPCR for mRNA expression levels

  • Immunohistochemistry with quantitative image analysis

ELISA kits for Rat Prima1 are particularly useful for quantitative measurements in cell culture supernatants, serum, plasma, and other biological fluids .

What experimental controls are critical when working with recombinant Prima1?

Critical experimental controls include:

  • Expression vector-only controls without the Prima1 insert

  • Inactive Prima1 mutants (site-directed mutagenesis of key residues)

  • Species-matched controls when comparing across different organisms

  • Positive controls using well-characterized Prima1 preparations

  • Antibody validation controls including preabsorption with the antigen and omitting primary or secondary antibodies

These controls help ensure the specificity and reliability of experimental results, similar to control approaches used in studies of other synaptic proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.