Recombinant Rat Proline-rich protein 7 (Prr7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Proline-rich Protein 7 (Prr7)

Recombinant Rat Proline-rich Protein 7 (Prr7) is a synthetic version of the endogenous transmembrane protein PRR7, engineered for research applications. Native PRR7 is a synaptic protein with roles in synapse elimination and immune cell regulation. Its recombinant form enables controlled studies of its structural and functional properties in vitro and in vivo, particularly in neurobiology and immunology.

Molecular Architecture

Recombinant Prr7 retains the key structural features of endogenous PRR7, including:

  • Single transmembrane domain: Anchors the protein to cellular membranes .

  • Proline-rich regions: Facilitates interactions with SH3 domain-containing proteins (e.g., adaptor molecules) .

  • C-terminal PDZ-binding motif (TTAV): Mediates binding to postsynaptic density (PSD) proteins like PSD-95 .

  • WW domain-binding motifs (PPXY): Supports interactions with WW domain-containing proteins (e.g., YAP) .

FeatureDescriptionSource
Transmembrane DomainSingle-pass α-helix spanning the membrane
Proline-Rich RegionsMultiple PXXP motifs for SH3 binding
PDZ-Binding MotifC-terminal TTAV sequence for PSD-95 interaction

Synaptic Regulation

  • Exosome-mediated synapse elimination: Secreted via exosomes, Prr7 induces excitatory synapse removal by inhibiting Wnt signaling and promoting proteasomal degradation of PSD proteins .

  • Homeostatic synaptic plasticity (HSD): Downregulation of Prr7 in dendrites is required for spine density reduction during chronic activity .

Immune Cell Regulation

  • T-cell activation: Upregulated during TCR stimulation, modulating IL-2 production and CD69 expression .

  • Apoptosis induction: Overexpression triggers Src-dependent apoptosis via WW domain-mediated pathways .

Synaptic Plasticity Studies

  • HSD mechanisms:

    • miRNA regulation: miR-329-3p and miR-495-3p suppress Prr7 translation, enabling dendritic spine elimination .

    • SPAR/CDK5 pathway interaction: Prr7 loss reduces SPAR (a synaptic scaffolding protein), linking Prr7 to CDK5-mediated homeostasis .

miRNAMechanism of ActionOutcomeSource
miR-329-3pTargets Prr7 3’ UTR, inhibits translationReduced dendritic Prr7
miR-495-3pSynergizes with miR-329-3p for additive repressionEnhanced HSD in PTX-treated neurons

Immune Function Studies

  • T-cell signaling:

    • SFK inhibition: Prr7 overexpression reduces Lck kinase levels and TCRζ phosphorylation, dampening proximal signaling .

    • C-Jun activation: Induces c-Jun expression, promoting CD69 upregulation and IL-2 secretion .

  • Knockout models: Prr7-deficient mice show normal T-cell development and immune responses, suggesting redundancy in endogenous Prr7 roles .

Production Parameters

ParameterDetailSource
AA Sequence1–269 residues (rat ortholog: P0C6T3)
TagTris-based buffer, 50% glycerol
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

Applications in Research

  • ELISA assays: Used to quantify Prr7 levels in neuronal lysates or immune cell extracts .

  • Overexpression studies: Transfected into hippocampal neurons or Jurkat T-cells to model synapse elimination or apoptosis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please include your preference in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary based on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice is required, kindly inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to meet your specific tag type requirements. Please communicate your desired tag type, and we will prioritize its development during production.
Synonyms
Prr7; Proline-rich protein 7; Synaptic proline-rich membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Prr7
Target Protein Sequence
MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPPPPHRSRLEAPVHAHSHVHVHPLLHHGPAQPHAHPHPHHHALPHPPPSHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAAPCPALCLQADRSRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV
Uniprot No.

Target Background

Function
Proline-rich protein 7 (Prr7) serves as a synapse-to-nucleus messenger, promoting NMDA receptor-mediated excitotoxicity in neurons through a JUN-dependent pathway. It inhibits ubiquitination-mediated degradation, leading to increased phosphorylation and transcriptional activity of the transcription factor JUN. Prr7 might also play a redundant role in regulating T cell receptor signaling and potentially promotes apoptosis in T cells.
Gene References Into Functions
  1. Prr7 is involved in modulating neural activities through interactions with the NMDA receptor and postsynaptic density (PSD)-95, and PSD core formation. PMID: 15629447
Database Links
Subcellular Location
Cell membrane; Single-pass type III membrane protein. Cell junction, synapse, postsynaptic cell membrane; Single-pass type III membrane protein. Cell junction, synapse, postsynaptic density membrane. Cytoplasm, perinuclear region. Cell junction, synapse. Cell projection, dendrite. Nucleus.
Tissue Specificity
Expressed in brain. Expressed in the cerebral cortex and especially in hippocampal neural cells (at protein level).

Q&A

What is Rat Proline-rich protein 7 (Prr7) and what are its key structural features?

Rat Proline-rich protein 7 (Prr7) is a transmembrane protein characterized by its high proline content. Key structural features include:

  • A transmembrane domain (TM)

  • A short N-terminal region

  • A proline-rich intracellular domain

  • A potential bipartite nuclear localization signal in the C-terminus

Studies have shown that the amino acid sequence of rat Prr7 contains:

  • Approximately 18% proline residues

  • Significant hydrophobic content

  • A PDZ-binding motif at the C-terminus that allows interaction with scaffolding proteins

The full-length rat Prr7 protein sequence (P0C6T3) spans positions 1-269 and includes a characteristic intracellular domain that follows the transmembrane segment . The proline-rich regions are particularly important for protein-protein interactions and proper folding, as demonstrated in studies of other proline-rich proteins .

What is the expression pattern of Prr7 in rat tissues?

Prr7 exhibits tissue-specific and developmentally regulated expression patterns:

  • Brain expression: Highly expressed in rat forebrain with developmental regulation showing expression beginning at postnatal day 7 and plateauing approximately 4 weeks after birth

  • Subcellular distribution: Punctate distribution throughout synaptodendritic compartments with significant colocalization with synaptic markers

  • Synaptic localization: Approximately 38.8 ± 3.6% of bona fide synapses (containing both PSD95 and Bassoon) contain Prr7

  • Subcellular fractionation: Markedly enriched in the postsynaptic density (PSD) fraction, but also present in purified nuclear fractions

Table 1. Quantitative analysis of Prr7 expression in subcellular compartments

Subcellular compartmentRelative Prr7 enrichmentStandard error
Synaptic fractionHighVariable
Nuclear fractionModerate to highVariable
Perinuclear regionLow to moderateLower
Dendritic shaftLow to moderateLower

What are the primary functions of Prr7 in neural tissues?

Prr7 is involved in several critical neuronal processes:

  • Synapse-to-nucleus signaling: Acts as a messenger between synapses and the nucleus to promote NMDA receptor-mediated excitotoxicity in a c-Jun-dependent manner

  • Regulation of ubiquitination: Inhibits ubiquitination-mediated degradation of the transcription factor c-Jun

  • Apoptotic regulation: Promotes phosphorylation and transcriptional activity of c-Jun, potentially promoting apoptosis in certain contexts

  • Spine density regulation: Prr7 knockdown in hippocampal neurons leads to significant decreases in dendritic spine density, while overexpression increases spine density by approximately 34%

  • Homeostatic scaling: Down-regulation of Prr7 is necessary for homeostatic scaling down (HSD) in neurons

Research indicates that Prr7's functions may be regulated by post-translational modifications and protein-protein interactions that affect its localization and activity in different neuronal compartments.

How can recombinant rat Prr7 be produced for research applications?

Production of recombinant rat Prr7 typically follows these methodological steps:

  • Expression system selection: Most commonly, E. coli-based expression systems are used for Prr7 production, similar to other recombinant proteins

  • Vector construction:

    • Clone the rat Prr7 coding sequence (positions 1-269) into an appropriate expression vector

    • Add a purification tag (His-tag, GST, etc.) to facilitate purification

    • Consider using codon-optimized sequences for E. coli expression

  • Expression conditions:

    • Induce protein expression at lower temperatures (16-25°C) to improve folding

    • Use rich media supplemented with additives that stabilize hydrophobic proteins

    • Optimize induction time and concentration of inducing agent

  • Purification protocol:

    • Lyse cells in buffer containing mild detergents to solubilize the transmembrane domain

    • Employ affinity chromatography using the fusion tag

    • Follow with size exclusion chromatography for higher purity

  • Quality control:

    • Verify protein integrity by SDS-PAGE

    • Confirm identity with Western blotting using specific antibodies

    • Assess folding using circular dichroism spectroscopy

Table 2. Recommended buffer compositions for rat Prr7 purification

Purification stepBuffer compositionpHTemperature
Cell lysis50 mM Tris-HCl, 150 mM NaCl, 1% Triton X-100, protease inhibitors7.54°C
Affinity chromatography20 mM Tris-HCl, 500 mM NaCl, 20 mM imidazole (for His-tag)8.04°C
Elution20 mM Tris-HCl, 500 mM NaCl, 250 mM imidazole8.04°C
Size exclusionPBS (phosphate-buffered saline)7.44°C

What are appropriate storage conditions for recombinant Prr7?

For optimal stability and activity of recombinant Prr7, implement the following storage protocols:

  • Lyophilization: Lyophilize from a 0.2 μm filtered solution in PBS with bovine serum albumin (BSA) as a carrier protein for enhanced stability

  • Reconstitution: Reconstitute at 100 μg/mL in PBS containing at least 0.1% human or bovine serum albumin

  • Temperature: Store lyophilized protein at -20°C or -80°C

  • Aliquoting: Prepare single-use aliquots to avoid repeated freeze-thaw cycles

  • Carrier-free option: For applications where BSA might interfere, carrier-free formulations can be used but may have reduced stability

Table 3. Storage stability comparison of different Prr7 formulations

FormulationStorage temperatureStability periodNotes
Lyophilized with BSA-20°C12+ monthsPreferred for general use
Lyophilized carrier-free-20°C6-12 monthsFor applications where BSA interferes
Reconstituted with BSA4°C1-2 weeksFor immediate use
Reconstituted carrier-free4°C3-7 daysReduced stability

How does Prr7 interact with NMDA receptors and what methodologies can reveal its role in excitotoxicity?

Prr7 directly interacts with NMDA receptors through specific domains and mechanisms:

  • Interaction domains: Prr7 binding to NMDARs requires its transmembrane domain (TM), short N-terminus, and approximately 15 amino acids of the intracellular domain

  • Subunit specificity: Prr7 binds to the GluN1 subunit of NMDARs and does not require GluN2A or GluN2B subunits for this interaction

  • Selectivity: Prr7 does not bind to AMPA receptor subunits GluA1 or GluA2, indicating specificity for NMDARs

To investigate Prr7's role in NMDAR-mediated excitotoxicity, researchers can employ these methodologies:

  • Co-immunoprecipitation assays:

    • Use antibodies against Prr7 or NMDAR subunits to pull down protein complexes

    • Analyze by Western blotting to detect interaction partners

    • Compare binding under normal and excitotoxic conditions

  • FRET/FLIM imaging:

    • Express fluorescently tagged Prr7 and NMDAR subunits

    • Measure Förster resonance energy transfer to quantify protein proximity

    • Analyze changes in FRET efficiency during excitotoxic insults

  • Excitotoxicity assays:

    • Use primary neuronal cultures with Prr7 knockdown or overexpression

    • Apply NMDA receptor agonists to induce excitotoxicity

    • Measure cell death using propidium iodide staining or LDH release

    • Compare Prr7-modified neurons with controls

  • Nuclear translocation studies:

    • Track Prr7 movement from synapses to nucleus using photoconvertible tags (e.g., mEos3.2)

    • Correlate nuclear accumulation with excitotoxic signaling events

    • Analyze using high-resolution confocal or super-resolution microscopy

Research has shown that Prr7 knockdown significantly attenuates NMDAR-mediated excitotoxicity in neuronal cultures in a c-Jun-dependent manner , suggesting it plays a critical role in this pathological process.

What techniques are effective for studying miRNA-mediated regulation of Prr7 in homeostatic synaptic plasticity?

miRNA-mediated regulation of Prr7 plays a crucial role in homeostatic scaling down (HSD) in neurons. These methodologies can effectively investigate this process:

  • miRNA target prediction and validation:

    • Use bioinformatic tools (e.g., TargetScan) to identify potential miRNA binding sites in the Prr7 3'UTR

    • Generate luciferase reporters with the Prr7 3'UTR downstream of firefly luciferase

    • Create binding site mutants to confirm direct targeting

  • miRNA inhibition studies:

    • Use locked nucleic acid (LNA) inhibitors to block specific miRNAs (e.g., miR-329-3p and miR-495-3p)

    • Apply during homeostatic plasticity induction (e.g., PTX treatment)

    • Measure effects on Prr7 expression and spine density

  • Compartmentalized culture systems:

    • Use microfluidic chambers to separate neuronal cell bodies from dendrites

    • Analyze Prr7 regulation separately in somatic vs. dendritic compartments

    • Compare subcellular differences in miRNA activity

  • Time-course analysis:

    • Sample neurons at different time points after plasticity induction

    • Quantify Prr7 mRNA, protein levels, and miRNA expression

    • Correlate changes with functional and structural alterations

Table 4. Effect of miRNA inhibitors on Prr7 expression in homeostatic scaling

Experimental conditionPrr7 protein levels in dendritesEffect on spine density
ControlBaselineBaseline
PTX treatmentDecreasedDecreased
PTX + miR-329-3p inhibitorPartial rescuePartial rescue
PTX + miR-495-3p inhibitorPartial rescuePartial rescue
PTX + both inhibitorsComplete rescueComplete rescue

Research has identified that miR-329-3p and miR-495-3p directly target the Prr7 3'UTR and mediate its downregulation during homeostatic scaling down . This regulatory mechanism appears to be especially important in the dendritic compartment.

What methods are most effective for investigating the subcellular localization and trafficking of Prr7?

To effectively study Prr7's subcellular localization and trafficking dynamics, researchers can employ these advanced techniques:

  • Live-cell imaging with photoconvertible proteins:

    • Express Prr7 fused to mEos3.2 or other photoconvertible tags

    • Photoconvert subsets of Prr7 in specific cellular compartments

    • Track movement between compartments over time

  • Super-resolution microscopy:

    • Apply STORM, PALM, or STED microscopy for nanoscale resolution

    • Co-visualize Prr7 with organelle markers and interaction partners

    • Quantify co-localization at synapses versus nuclear regions

  • FRAP (Fluorescence Recovery After Photobleaching):

    • Bleach fluorescently tagged Prr7 in specific compartments

    • Measure recovery kinetics to determine mobility

    • Compare trafficking rates under different stimulation conditions

  • Subcellular fractionation and Western blotting:

    • Isolate postsynaptic density, nuclear, and cytosolic fractions

    • Quantify Prr7 distribution across fractions by Western blot

    • Compare distribution changes after neuronal activity modulation

  • Activity-dependent trafficking studies:

    • Apply NMDAR agonists/antagonists to activate/block Prr7 trafficking

    • Quantify redistribution between synaptic and nuclear compartments

    • Analyze using time-lapse imaging or fixed-cell approaches

Table 5. Subcellular distribution of Prr7 under different experimental conditions

ConditionSynaptic Prr7Nuclear Prr7Methodology
Baseline++++Immunofluorescence
NMDA treatment (10 μM)++++Live imaging of PRR7-GFP
NMDA + MK-801++++Live imaging of PRR7-GFP

Research has shown that Prr7 exhibits a punctate distribution throughout synaptodendritic compartments under basal conditions, with approximately 38.8 ± 3.6% of bona fide synapses containing Prr7 . Upon NMDA receptor activation, Prr7 undergoes translocation to the nucleus, functioning as a synapse-to-nucleus messenger.

How can researchers analyze Prr7's effects on gene expression and transcriptional regulation?

To investigate Prr7's role in transcriptional regulation, particularly its effects on c-Jun-dependent gene expression, these methodologies are recommended:

  • Microarray or RNA-seq analysis:

    • Compare transcriptomes between Prr7-overexpressing, knockdown, and control neurons

    • Perform pathway analysis to identify affected gene networks

    • Validate key targets with RT-qPCR

  • Luciferase reporter assays:

    • Use AP-1 (activator protein 1) reporters to measure c-Jun transcriptional activity

    • Compare activity in the presence/absence of Prr7

    • Analyze the effects of Prr7 mutations on reporter activation

  • ChIP-seq (Chromatin Immunoprecipitation Sequencing):

    • Perform ChIP for c-Jun in Prr7-modified versus control cells

    • Identify genome-wide binding patterns and target genes

    • Correlate with expression changes from transcriptomic analysis

  • Proximity ligation assays:

    • Detect in situ interactions between Prr7, c-Jun, and related factors

    • Quantify interactions under different stimulation conditions

    • Localize interaction events to specific subcellular compartments

Research has demonstrated that Prr7 expression directly correlates with transcripts associated with cellular viability . Microarray data have shown that Prr7 abundance affects the expression of genes involved in apoptosis and cell survival pathways. When Prr7 inhibits the ubiquitination of c-Jun, it leads to increased phosphorylation and transcriptional activity of this important transcription factor.

What experimental approaches are suitable for studying Prr7's role in dendritic spine morphology?

To investigate Prr7's functions in spine density regulation and morphology, employ these methodologies:

  • Genetic manipulation approaches:

    • Generate shRNA constructs for Prr7 knockdown using validated targeting sequences (e.g., 5'-CGGAATCGGACATGTCTAA-3')

    • Create shRNA-resistant Prr7 constructs for rescue experiments

    • Utilize domain-specific mutants to identify functional regions

  • High-resolution spine imaging:

    • Transfect neurons with GFP to visualize dendritic morphology

    • Image using confocal or two-photon microscopy

    • Perform automated spine detection and classification

  • Quantitative spine analysis:

    • Measure spine density (spines per μm of dendrite)

    • Classify spine morphology (mushroom, thin, stubby)

    • Analyze spine head diameter and neck length

    • Compare between experimental conditions

  • Time-lapse spine dynamics:

    • Image live neurons over hours to days

    • Track spine formation, elimination, and morphological changes

    • Correlate dynamics with Prr7 expression levels

Table 6. Effects of Prr7 manipulation on dendritic spine parameters

ManipulationSpine density (relative to control)Spine head diameterSpine turnover rate
Control100%BaselineBaseline
Prr7 knockdownDecreased to PTX-comparable levelsDecreasedIncreased
Prr7 overexpressionIncreased ~34%IncreasedDecreased
Prr7 knockdown + rescueRestored to controlRestored to controlRestored to control
PTX treatmentDecreasedDecreasedIncreased
PTX + Prr7 overexpressionPrevention of decreasePrevention of decreasePrevention of increase

Research has shown that Prr7 knockdown in hippocampal neurons leads to a significant decrease in dendritic spine density to levels comparable to those induced by PTX treatment, while Prr7 overexpression increases spine density by approximately 34% . These findings suggest that Prr7 is a critical regulator of spine formation and/or maintenance in neurons.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.