Recombinant Rat Proline-rich transmembrane protein 1 (Prrt1)

Shipped with Ice Packs
In Stock

Description

Introduction

Proline-rich transmembrane protein 1 (PRRT1) is a protein-coding gene . PRRT1 is associated with diseases including Alzheimer's Disease and Delayed Sleep Phase . The rat homolog, Prrt1, is predicted to play a role in long-term synaptic depression, protein localization to the cell surface, and the regulation of AMPA receptors .

Protein Function and Significance

PRRT1 is essential for maintaining a pool of extrasynaptic AMPA-regulated glutamate receptors (AMPARs), which is critical for both synapse development and function . Studies indicate that PRRT1 may impair tetanus-induced long-term potentiation (LTP) .

Gene Interactions

Expression of the Prrt1 gene in rats can be influenced by various compounds :

  • Increased Expression: Acetamide, aristolochic acid A, atrazine, benzo[a]pyrene, folic acid, furan, pirinixic acid, quercetin, triptonide and valproic acid

  • Decreased Expression: All-trans-retinoic acid, amitrole, beta-lapachone, bisphenol A, gentamycin, iron dichloride, methimazole, O-methyleugenol, paracetamol, paraquat, propylthiouracil, resveratrol, SB 431542, sodium arsenite, testosterone, and thimerosal

  • Affects Methylation: Arsane, arsenic atom, benzo[a]pyrene, fonofos, parathion, terbufos, and titanium dioxide

  • Affects Expression: Lead diacetate, lead(0), paracetamol and tris(2-butoxyethyl) phosphate

  • Multiple Interactions: Bisphenol A, maneb, pirinixic acid, resveratrol, SB 431542, succimer

Data Table: Chemical Interactions with Rat Prrt1 Gene Expression

CompoundEffect on Expression
AcetamideIncreases expression
All-trans-retinoic acidDecreases expression
AmitroleDecreases expression
Aristolochic acid AIncreases expression
AtrazineIncreases expression
Benzo[a]pyreneIncreases expression, affects methylation
Beta-lapachoneDecreases expression
Bisphenol ADecreases expression
Folic acidIncreases expression
FuranIncreases expression
GentamycinDecreases expression
Iron dichlorideDecreases expression
Lead diacetateAffects expression
MethimazoleDecreases expression
O-methyleugenolDecreases expression
ParacetamolAffects/Decreases expression
ParaquatDecreases expression
ParathionIncreases methylation
Pirinixic acidIncreases expression
PropylthiouracilDecreases expression
QuercetinIncreases expression
ResveratrolDecreases expression
SB 431542Decreases expression
Sodium arseniteDecreases expression
TerbufosIncreases methylation
TestosteroneDecreases expression
ThimerosalDecreases expression
Titanium dioxideDecreases methylation
TriptonideIncreases expression
Tris(2-butoxyethyl)phosphateAffects expression
Valproic acidIncreases expression

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
Prrt1; Ng5; Proline-rich transmembrane protein 1; Dispanin subfamily D member 1; DSPD1; Synapse differentiation-induced protein 4; SynDIG4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Prrt1
Target Protein Sequence
MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPIPPPQTAPSSHHHHHHHYHQSGTATLPRLG AGGLASAAAGAQRGPSSSATLPRPPHHAPPGPAAGAPPPGCATLPRMPPDPYLQETRFEG PLPPPPPAAAAPPPPAPAPTAQAPGFVVPTHAGAVGTLPLGGYVAPGYPLQLQPCTAYVP VYPVGTPYASGTPGGPGVTSTLPPPPQGPGLALLEPRRPPHDYMPIAVLTTICCFWPTGI IAIFKAVQVRTALARGDLVSAEIASREARNFSFISLAVGIAAMVLCTILTVVIIIAAQHH ENYWDP
Uniprot No.

Target Background

Function
Maintaining a pool of extrasynaptic AMPA-regulated glutamate receptors (AMPARs) is crucial for synapse development and function. This protein regulates basal AMPAR function and synaptic transmission during development, though its role is dispensable in mature hippocampal synapses. It also influences basal phosphorylation levels of the glutamate receptor GRIA1 and promotes GRIA1 and GRIA2 cell surface expression.
Gene References Into Functions
  1. Studies suggest that, despite sequence similarity with SynDIG1, SynDIG4 may function through a unique mechanism as an auxiliary factor for extrasynaptic GluA1-containing AMPA receptors. PMID: 26660156
Database Links
Protein Families
CD225/Dispanin family
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell junction, synapse.
Tissue Specificity
Expressed in the brain (at protein level). In brain, expressed in the neocortex and enriched in the hippocampus but only modestly expressed in the cerebellum. Expressed throughout the hippocampus but is most highly expressed in the CA1 region and the stra

Q&A

What is Prrt1 and what is its primary function in rat brain?

Prrt1 (Proline-rich transmembrane protein 1) is a type II transmembrane protein that has been identified as a component of AMPAR (α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor) complexes in rat brain tissue . Its primary function appears to be related to synaptic signaling and neuronal differentiation, with significant expression in various brain regions. Prrt1 belongs to the family of proteins that includes SynDIG1 (Synapse Differentiation Induced Gene 1), which has been shown to regulate AMPAR content and clustering at synapses . Unlike some related proteins, Prrt1 shows a distinct electrophoretic mobility of approximately 38 kDa on immunoblots of rat brain membrane homogenates, slightly higher than its predicted molecular weight of 31.4 kDa .

How does Prrt1 expression compare to other proline-rich proteins in rat brain?

Prrt1 exhibits distinct expression patterns compared to other proline-rich proteins in rat brain. While proline-rich proteins like SPRR1A are not expressed in intact normal heart but are massively induced in cardiomyocytes responding to biomechanical/ischemic stress , Prrt1 maintains consistent expression in neural tissues. Prrt1 can be detected using specific antibodies like L102/45, SD4/NG5.1, and SD4/NG5.73, which recognize different epitopes of the protein . Studies have shown that these antibodies do not compete for binding and likely have distinct, non-overlapping epitopes, providing reliable tools for Prrt1 detection in research contexts .

What cellular compartments typically contain Prrt1 in rat neurons?

Prrt1 is primarily localized in membrane-associated compartments of rat neurons, consistent with its identity as a transmembrane protein. Cellular fractionation studies demonstrate its enrichment in crude synaptosomal fractions, suggesting a role at synaptic sites . Unlike cytosolic proline-rich proteins, Prrt1 contains a hydrophobic transmembrane domain that anchors it to cellular membranes. Immunohistochemical analyses reveal Prrt1 distribution throughout neuronal structures, with particular concentration at synaptic regions where AMPAR complexes typically function in neurotransmission.

How does Prrt1 interact with AMPAR complexes in rat brain tissue?

Prrt1 has been identified as a component of AMPAR complexes, suggesting functional interactions similar to those observed with SynDIG1. While SynDIG1 has been shown to interact with AMPARs in heterologous cells and regulate AMPAR content and clustering at synapses , the precise molecular mechanisms of Prrt1-AMPAR interactions remain an active area of investigation. Current evidence suggests that Prrt1 may participate in regulating AMPAR trafficking or stabilization at synaptic sites. Researchers studying these interactions typically employ co-immunoprecipitation approaches with antibodies targeting either Prrt1 (using validated antibodies like L102/45) or AMPAR subunits such as GluA1 and GluA2, which have been shown to recognize single bands at approximately 100 kDa from rat brain tissue lysates .

What experimental approaches are most effective for studying Prrt1 function in neuronal circuits?

Multiple complementary approaches are recommended for investigating Prrt1 function:

  • Genetic manipulation strategies: CRISPR-Cas9 mediated knockout or knockdown using RNA interference techniques can reveal phenotypes associated with Prrt1 deficiency.

  • Electrophysiological recordings: Whole-cell patch-clamp recordings from neurons with altered Prrt1 expression can assess changes in AMPAR-mediated synaptic transmission.

  • Fluorescence imaging: Super-resolution microscopy of tagged Prrt1 constructs can reveal subcellular localization patterns.

  • Biochemical assays: Protein-protein interaction studies using pull-down assays or proximity labeling techniques can identify novel Prrt1 binding partners.

  • Behavioral assessments: Evaluating cognitive and behavioral changes in animal models with altered Prrt1 expression can link molecular findings to systems-level functions.

These approaches should be combined with appropriate controls and validation steps to ensure reliable interpretation of results.

How might Prrt1 function be affected by neurological disease states or pharmacological interventions?

Studies examining gene expression changes in rat brain following repeated oxycodone administration have identified numerous regulated genes involved in various biological processes, including organic anion transport (p = 7.251 × 10⁻⁴) and regulation of immune response (p = 5.090 × 10⁻⁴) . While specific regulation of Prrt1 was not directly reported in these studies, related transmembrane proteins involved in neural signaling often show altered expression in response to pharmacological interventions. The expression and function of membrane proteins like Prrt1 may be differentially regulated under conditions of substance exposure, neuroinflammation, or oxidative stress, potentially contributing to adaptive or maladaptive neuroplasticity.

What are optimal expression systems for producing recombinant rat Prrt1?

When producing recombinant rat Prrt1, researchers should consider the following expression systems and associated methodological considerations:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliCost-effective, high yield, rapid productionMay lack proper folding and post-translational modificationsUse specialized strains (Origami, Rosetta), optimize codons, express as fusion protein
Mammalian cells (HEK293, CHO)Native-like folding and modificationsHigher cost, lower yieldOptimize transfection conditions, select stable cell lines, use inducible promoters
Baculovirus-infected insect cellsGood for membrane proteins, intermediate modificationsMore complex setupOptimize MOI, harvest timing, expression temperature
Cell-free systemsRapid, avoids toxicity issuesLimited scale, expensiveSupplement with chaperones, optimize redox conditions

For transmembrane proteins like Prrt1, mammalian or insect cell expression systems typically yield the most functionally relevant protein products due to their ability to properly fold and insert membrane proteins.

What purification strategies are most effective for recombinant rat Prrt1?

Purification of recombinant rat Prrt1 presents challenges common to membrane proteins. Based on approaches used for similar proteins, the following multi-step purification strategy is recommended:

  • Membrane fraction isolation: Differential centrifugation to separate membrane fractions containing the expressed Prrt1 protein.

  • Detergent solubilization: Use mild detergents (DDM, CHAPS, or digitonin) to solubilize Prrt1 while maintaining native conformation.

  • Affinity chromatography: Employ tag-based purification (His-tag, FLAG-tag) or immunoaffinity approaches using validated antibodies like L102/45 or NG5.73 .

  • Size exclusion chromatography: Further purify based on molecular size to separate Prrt1 from aggregates or degradation products.

  • Quality control: Assess purity using SDS-PAGE and western blotting; verify functionality through binding assays with known interaction partners.

This approach typically yields protein with ~85-90% purity suitable for most biochemical and structural studies.

What are recommended antibodies and detection methods for rat Prrt1 studies?

Several antibodies have been validated for Prrt1 detection in rat brain tissue:

  • L102/45: A mouse monoclonal antibody that detects a single band at approximately 38 kDa in rat brain membrane homogenate when probed with an anti-IgG 2A secondary antibody .

  • SD4/NG5.1: A polyclonal rabbit antibody targeting amino acids 73-86 of the rat Prrt1 sequence that shows specific immunoreactivity for HA-tagged Prrt1 and detects predominant bands at 38 kDa on immunoblots of rat brain homogenate .

  • SD4/NG5.73: A polyclonal rabbit antibody targeting amino acids 1-14 of the rat Prrt1 sequence that also demonstrates specific immunoreactivity and detection of 38 kDa bands in rat brain homogenate .

Importantly, competition studies have shown that L102/45 and NG5.73 do not compete for binding, indicating they have distinct, non-overlapping epitopes despite targeting similar regions, which strengthens the reliability of results obtained with both antibodies .

How can researchers address variability in Prrt1 expression data across different experimental conditions?

When analyzing Prrt1 expression data, researchers should implement the following strategies to address variability:

  • Normalization approach: Use multiple reference genes (at least 3) for qPCR normalization, selected based on stability assessment algorithms like geNorm or NormFinder.

  • Statistical power considerations: Conduct power analyses before experiments to determine appropriate sample sizes (typically n≥6 for each experimental condition).

  • Validation across techniques: Confirm expression changes using orthogonal methods (e.g., qPCR to validate microarray findings), similar to approaches used in studies of oxycodone-regulated gene expression where Q-PCR validation showed strong correlation (r = 0.979, p < 0.0000001) with microarray data .

  • Biological context integration: Use computational platforms like MetaCore to identify broader biological processes affected by experimental conditions, as demonstrated in studies of oxycodone administration .

  • Experimental design factors: Control for circadian variations, animal handling stress, and other confounding factors that may influence neuronal gene expression.

What approaches help reconcile contradictory findings about Prrt1 function in different experimental models?

When confronted with contradictory findings regarding Prrt1 function, researchers should systematically evaluate:

  • Model system differences: Compare experimental details across studies, noting species, strain, age, and sex differences that may influence results.

  • Methodological variations: Assess differences in protein extraction methods, antibody specificities, and detection techniques. For instance, characterizing antibodies through competition studies can verify that they recognize distinct, non-overlapping epitopes as demonstrated for Prrt1 antibodies L102/45 and NG5.73 .

  • Contextual effects: Consider how environmental enrichment versus impoverishment affects neuronal protein expression and function. Studies on environmental effects have shown that enriched environments can significantly alter drug self-administration behaviors in rats .

  • Pathway analysis: Employ computational approaches to place contradictory findings within larger signaling networks, potentially revealing context-dependent functions of Prrt1.

  • Meta-analysis approaches: When sufficient published data exists, conduct formal meta-analyses to quantitatively assess the strength of evidence across studies.

How should researchers interpret Prrt1 expression changes in response to pharmacological interventions?

When analyzing Prrt1 expression changes in response to pharmacological interventions like opioids, researchers should consider:

  • Temporal dynamics: Examine both acute and chronic effects, as gene expression patterns often differ between these timeframes. For example, studies of repeated oxycodone administration have shown time-dependent regulation of various genes in rat brain tissues .

  • Brain region specificity: Analyze expression changes across different brain regions, as neural circuits may show differential sensitivity to interventions.

  • Pathway context: Place observed changes within broader cellular pathways. For instance, repeated opioid administration has been shown to induce MDR transporters like P-gp (Abcb1) in brain tissues of rats, potentially resulting in transporter-mediated drug-drug interactions .

  • Functional correlates: Connect expression changes to functional outcomes through behavioral assays or electrophysiological recordings.

  • Dose-response relationships: Determine whether expression changes show linear or non-linear relationships with drug concentrations.

This comprehensive approach helps distinguish between adaptive and potentially pathological responses to pharmacological challenges.

What emerging technologies might advance understanding of Prrt1 function in neural circuits?

Several cutting-edge technologies show promise for elucidating Prrt1 function:

  • Single-cell transcriptomics and proteomics: These approaches can reveal cell-type specific expression patterns of Prrt1 across neural populations, providing insights into its differential function in various neuronal subtypes.

  • CRISPR-based screening: High-throughput functional genomic screens can identify genes that interact with Prrt1 or modify phenotypes associated with Prrt1 manipulation.

  • Cryo-electron microscopy: Structural determination of Prrt1 alone or in complex with interaction partners could reveal mechanistic insights into its function in AMPAR complexes.

  • Optogenetic and chemogenetic tools: These can be combined with Prrt1 manipulation to assess its role in specific neural circuits under precisely controlled conditions.

  • In vivo calcium imaging: This technique allows real-time assessment of neuronal activity in animals with altered Prrt1 expression, linking molecular changes to circuit function.

How might comparative studies of Prrt1 across species inform human neurological disease research?

Comparative studies of Prrt1 across species can provide valuable insights through:

  • Evolutionary conservation analysis: Identifying highly conserved domains suggests functionally critical regions that may be relevant to human disease mechanisms.

  • Translational models: Validating findings from rat models in human-derived systems (iPSC neurons, organoids) can strengthen the relevance to human conditions.

  • Disease-specific variations: Examining how species-specific variations in Prrt1 correlate with differential susceptibility to neurological conditions could reveal protective or risk-conferring mechanisms.

  • Pharmacological responses: Comparing how Prrt1 responds to therapeutic agents across species may help predict human responses to potential treatments.

  • Regulatory network conservation: Assessing whether the regulatory pathways controlling Prrt1 expression are conserved across species provides context for interpreting experimental findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.