Recombinant Rat Prostaglandin D2 receptor-like (Ptgdrl)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Rat Prostaglandin D2 Receptor-Like (Ptgdrl) is a genetically engineered form of the rat prostaglandin D2 (PGD₂) receptor, a G protein-coupled receptor (GPCR) encoded by the Ptgdr gene. Ptgdrl was historically used as a provisional nomenclature but has since been standardized to Ptgdr in genomic databases . This receptor binds prostaglandin D₂, a lipid mediator involved in inflammation, neurotransmission, and immune regulation .

Recombinant Production Systems

Recombinant Ptgdrl is produced using mammalian expression systems, such as HEK293 cells, to ensure proper post-translational modifications. Available constructs include:

Product IDHost SystemTagProtein LengthReference
PTGDRL-4804RMammalian CellsHisFull-length
PTGDRL-4463RHEK293His-Fc-AviFull-length
RFL30836RFE. coliHis (N-terminal)1-357

Signal Transduction Pathways

PGD₂ binding activates distinct pathways depending on receptor subtype:

Receptor SubtypeG Protein CouplingSecond MessengerFunctional OutcomeReference
DP1 (PTGDR1)Gαs↑ cAMP, ↑ Ca²⁺Anti-inflammatory, vasodilation
DP2 (PTGDR2)Gαi↓ cAMP, ↑ IP₃Pro-inflammatory, immune cell recruitment

Key Biological Functions

  • Mast Cell Regulation: Ptgdrl mediates PLA2G3-dependent mast cell maturation and degranulation .

  • Neuroinflammation: Elevated PGD₂ levels in Alzheimer’s disease (AD) models correlate with microglial DP1 upregulation and neuronal DP2 loss .

  • Asthma Pathogenesis: Genetic variations in Ptgdr are linked to asthma susceptibility via T<sub>H</sub>2 cell activation .

Alzheimer’s Disease Studies

  • Therapeutic Targeting: DP2 antagonist timapiprant reduced Aβ plaque burden and cognitive deficits in TgF344-AD rats .

  • Receptor Distribution:

    • Microglial DP1 receptors increased by 2.5-fold in AD models.

    • Neuronal DP2 receptors decreased by 34% in the hippocampal granular cell layer .

Inflammatory and Allergic Models

  • Asthma: Ptgdr knockout mice showed attenuated mast cell-mediated airway inflammation .

  • Hair Growth Inhibition: PGD₂ binding to DP2 receptors suppresses follicular regeneration, implicating Ptgdrl in androgenetic alopecia .

Drug Development

  • Timapiprant (OC000459): A DP2 antagonist in clinical trials for asthma and AD, showing efficacy in reducing neuroinflammation .

  • GIF-0173: A DP1 agonist demonstrated neuroprotective effects in cerebral ischemia models .

Future Directions

  • Mechanistic Studies: Resolving the crystal structure of Ptgdrl to guide drug design.

  • Clinical Translation: Validating DP2 antagonists in Phase III trials for neurodegenerative and allergic diseases .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ptgdrl; Ptgdr2; Prostaglandin D2 receptor-like; PGD receptor-like; PGD2 receptor-like; Prostanoid DP receptor-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ptgdrl
Target Protein Sequence
MNESYRCQAATWVERGSSATMGGVLFSAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF YVLVCGLTVTHLLGKCLISPMVLAAYAQNRSLKELLPASGNQLCEAFAFLMSFFGLASTL QLLAMALECWLSLGHPFFYQRHITARRGVLVAPVAGAFSLAFCALPFAGFGKFVQYCPGT WCFIQMIHKKRSFSVIGFSVLYSSLMALLVLATVVCNLGAMSNLYAMHRRQRHHPRRCSR DRAQSGSDYRHGSPNPLEELDHFVLLALTTVLFTMCSLPLIYRAYYGAFKLVDRADGDSE DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKAFTRPLIYRNWCSHSWQTNMESTL
Uniprot No.

Target Background

Function
Prostaglandin D2 receptor-like (PTGDRL) is a receptor for prostaglandin D2 (PGD2). The receptor's activity is primarily mediated by G(s) proteins that stimulate adenylate cyclase, leading to an increase in intracellular cAMP. Calcium mobilization is also observed, but without the formation of inositol 1,4,5-trisphosphate.
Gene References Into Functions
  1. amino acid sequence alignment of human, mouse and rat DP receptors (also called prostaglandin D2 receptor) PMID: 12895603
  2. PGD2 receptor does not appear to be involved in the anti-enteropooling effect of PGD(2), as the selective agonists 13,14-dihydro-15-keto-PGD(2) and 15(R)-15-methyl-PGD(2) were ineffective PMID: 18212515
Database Links

KEGG: rno:63889

UniGene: Rn.110861

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Strongly expressed in eye and gastrointestinal tract (GIT), moderately in the brain and oviduct and weakly in the epididymis. In the eye, expressed in the epithelium of the iris and ciliary body and in photoreceptor cells of the retina. In the brain, expr

Q&A

What are the main types of Prostaglandin D2 receptors in rats?

Prostaglandin D2 (PGD2) binds to two distinct G protein-coupled receptors in rats, similar to humans: Prostaglandin D2 receptor 1 (DP1) and Prostaglandin D2 receptor 2 (DP2). These receptors are heterotrimeric G protein-coupled receptors containing seven rhodopsin-like transmembrane domains, with an extracellular NH2 terminus and an intracellular COOH terminus. Studies in rat models have shown significant differences in DP1 and DP2 receptor levels in different cell types, with DP1 predominant in microglia and DP2 in neurons. This cell-specific distribution suggests distinct physiological roles for each receptor subtype in the rat central nervous system .

How do Prostaglandin D2 signaling pathways function in rat models?

The PGD2 receptor signaling pathway in rats begins with PGD2 binding to the extracellular ligand site on either DP1 or DP2 receptors. For DP1, binding activates the Gs alpha subunit, which subsequently activates adenylate cyclase located on the cell membrane. This enzyme catalyzes the conversion of ATP to cyclic AMP (cAMP), resulting in elevated levels of this second messenger. The DP1 signaling pathway primarily operates through cAMP-dependent mechanisms, while DP2 generally couples to Gi proteins, inhibiting adenylate cyclase and decreasing cAMP production. This dual signaling system allows for complex regulation of neuroinflammatory processes and other physiological functions in rat models .

What is the tissue distribution of PGD2 receptors in rat models?

Research has demonstrated variable expression patterns of PGD2 receptors across rat tissues. In the central nervous system, particularly in the hippocampus, both DP1 and DP2 receptors show distinct cellular distribution patterns. DP1 receptors are predominantly expressed in microglial cells, while DP2 receptors are more abundant in neurons. Quantitative analysis has shown significant differences in receptor levels between wild-type and transgenic Alzheimer's disease rat models (TgF344-AD), suggesting altered PGD2 signaling in pathological conditions. Beyond the brain, these receptors are also found in airway tissues and reproductive organs, though with different expression patterns compared to human tissues .

What cloning strategies are most effective for producing recombinant rat PGD2 receptors?

Based on successful approaches with other rat recombinant proteins, an effective cloning strategy for rat PGD2 receptors would involve reverse transcriptase PCR to create cDNA of the coding region with unique restriction enzyme sites (such as BamHI) as flanking sequences. The coding region can then be cloned into a bacterial expression vector controlled by a T7 promoter. For optimal expression, transformation into Escherichia coli strain B21(DE3) followed by induction with isopropyl-β-D-thiogalactopyranoside (IPTG) has proven effective for similar recombinant rat proteins. This approach allows for the production of a fusion protein that can include polyhistidine and S-peptide sequences to facilitate isolation and identification, respectively .

How should researchers optimize purification protocols for recombinant rat PGD2 receptors?

Purification of recombinant rat PGD2 receptors requires careful optimization to maintain protein integrity and functionality. Affinity chromatography is the recommended primary purification method, particularly if the recombinant protein includes a polyhistidine tag. For quality control, gel electrophoresis and Western analysis should be performed to confirm identity and purity. Based on similar recombinant rat protein work, the purification should be conducted under conditions that minimize protein degradation, typically at 4°C with appropriate protease inhibitors. For lyophilization, a buffer system containing 20 mM sodium bicarbonate at pH 8.5 has been shown to maintain stability of similar recombinant rat proteins. This approach yields highly pure protein that can be rapidly isolated for subsequent experimental applications .

What expression systems provide optimal yields for functional recombinant rat PGD2 receptors?

While E. coli systems offer simplicity and cost-effectiveness for initial expression, mammalian expression systems often provide superior results for G protein-coupled receptors like PGD2 receptors. For researchers requiring properly folded and post-translationally modified receptors, Chinese Hamster Ovary (CHO) or Human Embryonic Kidney (HEK293) cell lines are recommended. These systems better accommodate the complex seven-transmembrane domain structure and potential glycosylation at the Asn-10, Asn-90, and Asn-297 residues that have been identified in prostaglandin D2 receptors. For researchers requiring large quantities with less concern for post-translational modifications, bacterial systems can be optimized with specialized strains and chaperone co-expression to improve folding of membrane proteins. Each system requires specific optimization of induction parameters, temperature, and purification protocols to maximize yield of functional protein .

How can antagonist binding studies be designed to evaluate recombinant rat PGD2 receptor functionality?

When designing antagonist binding studies for recombinant rat PGD2 receptors, researchers should employ a competitive binding assay using a labeled PGD2 ligand and varying concentrations of antagonists such as Timapiprant, which has demonstrated efficacy in rat models. The binding assay should be conducted at physiologically relevant temperatures (37°C) in a buffer system that maintains receptor stability. Scatchard analysis can then be used to determine binding constants. Functional assays should follow binding studies, measuring changes in secondary messenger (cAMP) levels to confirm that the receptors maintain proper signaling capabilities. In transgenic rat models, Timapiprant has been shown to effectively antagonize PGD2 receptors, suggesting it as a valuable tool for validating recombinant receptor functionality in both in vitro and in vivo studies .

What analytical techniques are recommended for characterizing the structural integrity of recombinant rat PGD2 receptors?

For comprehensive structural characterization of recombinant rat PGD2 receptors, a multi-technique approach is essential. Begin with SDS-PAGE under both reducing and non-reducing conditions to assess purity (≥95% is typically considered acceptable for research applications). Mass spectrometry should follow to confirm the expected molecular mass of approximately 40 kDa and to identify any post-translational modifications. Circular dichroism spectroscopy is valuable for secondary structure analysis, particularly to confirm the presence of the seven alpha-helical transmembrane domains characteristic of G protein-coupled receptors. For more detailed structural analysis, X-ray crystallography or cryo-electron microscopy may be employed, though these typically require specialized sample preparation. Finally, N-glycosylation analysis should be performed to verify modification at the expected residues (Asn-10, Asn-90, and Asn-297), which can significantly impact receptor functionality .

How should researchers design experiments to investigate the differential signaling of DP1 versus DP2 receptors in recombinant systems?

Designing experiments to investigate differential signaling between DP1 and DP2 receptors requires careful control of receptor expression and signaling pathway isolation. First, establish stable cell lines expressing either DP1 or DP2 receptors individually to prevent cross-talk. For DP1 signaling, measure increases in cAMP levels using ELISA or FRET-based reporters following stimulation with selective agonists. For DP2, which couples to Gi proteins, measure both the inhibition of adenylate cyclase and calcium mobilization. To specifically study cross-talk between pathways, co-express both receptors in controlled ratios and employ selective antagonists (such as Timapiprant for DP2) to isolate individual receptor contributions. Additionally, conduct siRNA knockdown experiments to further validate receptor-specific effects. Time-course experiments are essential, as DP1 and DP2 may exhibit different activation and desensitization kinetics that influence downstream signaling events relevant to neuroinflammation or other physiological processes .

What in vitro bioassays effectively measure the functional activity of recombinant rat PGD2 receptors?

For assessing recombinant rat PGD2 receptor functionality, researchers should implement a comprehensive panel of bioassays targeting different aspects of receptor activity. A primary assay should measure second messenger production—cAMP accumulation assays for DP1 receptors (which couple to Gs) and inhibition of forskolin-stimulated cAMP production for DP2 receptors (which couple to Gi). These can be quantified using ELISA or bioluminescence-based reporter systems. For DP2 receptors, calcium mobilization assays using fluorescent calcium indicators provide additional functional data. Receptor internalization assays using fluorescently tagged receptors offer insights into receptor trafficking dynamics. Finally, cell proliferation assays similar to those used for recombinant rat GM-CSF can assess downstream biological effects, with ED50 values of active recombinant receptors typically in the nanogram range. All assays should include appropriate positive controls (native PGD2) and negative controls (untransfected cells) to validate receptor-specific responses .

How can researchers effectively compare endogenous versus recombinant rat PGD2 receptor signaling?

To effectively compare endogenous versus recombinant rat PGD2 receptor signaling, researchers should employ a systematic approach with carefully matched experimental conditions. Begin by quantifying receptor expression levels in both systems using quantitative PCR and Western blotting to establish baseline comparisons. Follow with dose-response studies using identical PGD2 concentrations (typically ranging from 0.1 nM to 1 μM) in both systems, measuring canonical signaling outputs like cAMP levels for DP1 and calcium flux for DP2. Time-course experiments are crucial, as recombinant systems may exhibit altered desensitization kinetics compared to endogenous receptors. Use selective antagonists like Timapiprant to confirm receptor subtype specificity in both systems. Finally, evaluate downstream gene expression changes using RNAseq to identify potential signaling divergences. Studies with rat pancreatic recombinant proteins have demonstrated that recombinant proteins can sometimes exhibit higher potency than their endogenous counterparts, a phenomenon that should be carefully controlled for when interpreting experimental results .

ParameterEndogenous PGD2 ReceptorsRecombinant PGD2 ReceptorsNotes for Researchers
Expression LevelVariable, tissue-dependentControllable, often higherNormalize data to receptor density
EC50 for PGD22-5 nM (typical range)May be lower due to higher accessibilityCompare potency ratios rather than absolute values
Desensitization RateNormal physiological timingMay be altered due to expression contextConduct time-course experiments
Post-translational ModificationsComplete, native patternMay be incomplete depending on expression systemVerify glycosylation status
Signaling PartnersComplete endogenous complementMay lack tissue-specific cofactorsConsider reconstitution experiments

How do alterations in PGD2 receptor expression correlate with pathological conditions in rat models?

Research using transgenic rat models of Alzheimer's disease (Tg-AD) has revealed significant alterations in PGD2 receptor expression compared to wild-type controls. Specifically, there are notable differences in DP1 and DP2 receptor levels in microglial cells and neurons, respectively. In the hippocampus of Tg-AD rats, these alterations correlate with increased neuroinflammation, cognitive deficits, and Aβ plaque formation. Quantitative analysis of hippocampal tissue from 11-month-old rats shows that while PGD2 levels are similar between wild-type and Tg-AD rats (approximately 49.1 ± 4.1 pg/mg wet tissue), the receptor distribution and downstream signaling pathways show significant dysregulation. Transcriptome assessment identified L-PGDS as the most abundant mRNA among 33 genes analyzed in the PGD2 pathway, suggesting its potential role in disease pathogenesis. These findings provide valuable insights into how PGD2 receptor alterations contribute to neuroinflammatory processes in neurodegenerative conditions .

What experimental approaches best demonstrate the efficacy of PGD2 receptor antagonists in neuroinflammatory models?

To effectively demonstrate the efficacy of PGD2 receptor antagonists in neuroinflammatory models, a multi-faceted experimental approach is essential. Begin with in vitro studies using primary microglial cultures from rats to establish direct anti-inflammatory effects, measuring cytokine production (IL-1β, TNF-α, IL-6) following PGD2 stimulation with and without antagonist treatment. Progress to ex vivo slice cultures to assess effects on neural circuit function. For in vivo studies, transgenic rat models of Alzheimer's disease (such as TgF344-AD rats expressing human APPswe and PS1ΔE9) provide an ideal system for testing antagonist efficacy. Treatment protocols should include both preventative (starting before pathology develops) and therapeutic (after pathology is established) paradigms. Comprehensive assessment should include cognitive testing (Morris water maze, novel object recognition), neuroinflammatory markers (IBA1+ microglia quantification), and Aβ plaque burden. Studies with Timapiprant, a DP2 receptor antagonist, have demonstrated significant amelioration of pathology and cognitive deficits in transgenic rat models, establishing a methodological framework for testing novel compounds .

How can recombinant rat PGD2 receptors be utilized in high-throughput screening for novel therapeutics?

Developing a high-throughput screening (HTS) platform using recombinant rat PGD2 receptors requires careful optimization of receptor expression, assay conditions, and detection methods. The optimal approach utilizes stable cell lines expressing either DP1 or DP2 receptors in a 384-well format. For DP1 receptors, cAMP accumulation assays using bioluminescence resonance energy transfer (BRET)-based sensors provide a robust and sensitive readout suitable for automation. For DP2 receptors, calcium flux assays using fluorescent indicators offer rapid kinetic data appropriate for HTS applications. Assay optimization should include DMSO tolerance testing (typically limiting concentrations to <1%), Z'-factor determination (aim for >0.7 for robust screening), and validation with known antagonists such as Timapiprant. Counter-screening against related prostanoid receptors is essential to identify selective compounds. Based on successful approaches with other G protein-coupled receptors, this platform should be capable of screening approximately 10,000-50,000 compounds per day, with hit rates typically ranging from 0.1-1%. Confirmed hits should subsequently undergo secondary functional assays, including measurements of effects on microglial activation and neuroinflammatory cytokine production .

How should researchers address discrepancies between in vitro and in vivo PGD2 receptor function studies?

When confronted with discrepancies between in vitro and in vivo PGD2 receptor function studies, researchers should systematically investigate several potential contributing factors. First, examine receptor expression levels between systems, as overexpression in recombinant systems can alter signaling dynamics compared to physiological levels in vivo. Second, consider the microenvironment differences—in vivo systems contain complex cell-cell interactions and extracellular matrix components that may modulate receptor function through allosteric mechanisms. Third, evaluate differences in post-translational modifications, particularly N-glycosylation at the Asn-10, Asn-90, and Asn-297 residues, which can significantly impact receptor pharmacology. Fourth, investigate the presence of receptor splice variants or isoforms that may be differentially expressed between systems. To reconcile discrepancies, perform parallel studies using primary cell cultures that maintain physiological receptor levels while allowing controlled experimental conditions. Additionally, validate findings using multiple antagonists or agonists with different chemical scaffolds to rule out compound-specific effects. Finally, consider employing tissue-specific knockout models to definitively establish receptor-mediated effects in vivo .

What are the common pitfalls in analyzing PGD2 receptor signaling in recombinant systems?

Researchers analyzing PGD2 receptor signaling in recombinant systems should be aware of several common pitfalls that can compromise experimental validity. First, receptor overexpression frequently leads to altered signaling kinetics and potential constitutive activity not observed at physiological expression levels. Second, heterologous expression systems often lack the full complement of signaling partners present in native tissues, potentially masking important signaling pathways. Third, recombinant receptors may exhibit improper folding or trafficking, resulting in intracellular retention and reduced surface expression. Fourth, PGD2 is chemically unstable and can spontaneously degrade to produce PGJ2 (measured at approximately 2.0 ± 0.2 pg/mg in rat hippocampal tissue), which activates different signaling pathways. To mitigate these issues, researchers should quantify surface receptor expression using flow cytometry or surface biotinylation assays, verify proper G-protein coupling through GTPγS binding assays, use freshly prepared PGD2 solutions, and include appropriate positive and negative controls in all experiments. Additionally, comparing results across multiple expression systems can help identify system-specific artifacts versus genuine receptor properties .

How can researchers distinguish between DP1 and DP2 receptor-mediated effects in complex biological systems?

Distinguishing between DP1 and DP2 receptor-mediated effects in complex biological systems requires a strategic combination of pharmacological, genetic, and analytical approaches. Begin with subtype-selective agonists and antagonists—BW245C is relatively selective for DP1, while 15(R)-PGD2 preferentially activates DP2. Similarly, employ selective antagonists like Timapiprant (DP2-selective) in parallel experiments. Complement pharmacological approaches with genetic tools such as siRNA knockdown or CRISPR-mediated receptor deletion, targeting each receptor subtype individually. For signaling pathway dissection, use selective pathway inhibitors: PKA inhibitors for DP1-mediated (cAMP-dependent) effects and pertussis toxin for DP2-mediated (Gi-dependent) effects. Temporal analysis is also valuable, as DP1 and DP2 often exhibit different activation and desensitization kinetics. In rat hippocampal tissue, where both receptors are expressed but in different cell types (DP1 in microglia, DP2 in neurons), cell-type specific markers can help attribute observed effects to the appropriate receptor subtype. Finally, consider using transcriptomic approaches to identify receptor subtype-specific gene expression signatures that can serve as biomarkers of receptor activation .

What emerging technologies show promise for studying PGD2 receptor dynamics in real-time?

Emerging technologies for studying PGD2 receptor dynamics in real-time offer unprecedented insights into receptor function. CRISPR-based gene editing combined with fluorescent protein tagging allows visualization of native receptor trafficking in living cells without overexpression artifacts. Advanced fluorescence techniques such as Fluorescence Resonance Energy Transfer (FRET) and Bioluminescence Resonance Energy Transfer (BRET) enable real-time monitoring of receptor-ligand and receptor-effector interactions with temporal resolution in the millisecond range. Nanobody-based biosensors provide another approach for detecting conformational changes associated with receptor activation. For in vivo applications, fiber photometry and miniscope imaging technologies permit visualization of receptor activity in freely moving animals through genetically encoded calcium or cAMP indicators downstream of receptor activation. Single-molecule imaging techniques like total internal reflection fluorescence (TIRF) microscopy offer insights into receptor oligomerization and membrane dynamics. These approaches, when applied to rat PGD2 receptors, can reveal dynamic aspects of signaling not captured by traditional biochemical methods, particularly the temporal relationships between DP1 (predominantly in microglia) and DP2 (predominantly in neurons) activation in complex tissues like the hippocampus .

How might genetically modified rat models advance our understanding of PGD2 receptor function in neuroinflammation?

The development of sophisticated genetically modified rat models represents a significant opportunity to advance our understanding of PGD2 receptor function in neuroinflammation. CRISPR/Cas9 technology now enables the creation of conditional, cell-type specific receptor knockout rats, allowing researchers to selectively delete DP1 or DP2 receptors in microglia or neurons, respectively. These models would help delineate the specific contributions of each receptor subtype to neuroinflammatory processes. Knock-in models expressing fluorescently tagged receptors at endogenous levels would facilitate in vivo imaging of receptor dynamics during inflammatory responses. Reporter rats expressing luciferase or fluorescent proteins downstream of PGD2 receptor activation could serve as biosensors for receptor activity across different brain regions. Combined genetic models—such as crosses between PGD2 receptor knockouts and the TgF344-AD rat model that expresses human APPswe and PS1ΔE9 mutations—would clarify the role of these receptors in neurodegenerative pathology, building on findings that Timapiprant (a DP2 antagonist) ameliorates pathology and cognitive deficits in this model. These advanced genetic approaches would complement pharmacological studies and potentially identify new therapeutic targets within the PGD2 signaling pathway .

What are the most promising computational approaches for predicting novel PGD2 receptor ligands with therapeutic potential?

Advanced computational approaches offer powerful tools for identifying novel PGD2 receptor ligands with therapeutic potential. Structure-based virtual screening utilizing homology models based on the seven-transmembrane domain structure of PGD2 receptors can efficiently screen millions of compounds in silico. Machine learning algorithms trained on known PGD2 receptor ligands can generate predictive models that identify novel chemical scaffolds with high probability of receptor binding. Molecular dynamics simulations provide insights into ligand-receptor interactions and conformational changes associated with receptor activation or antagonism. Fragment-based drug design approaches can systematically build compounds with optimal binding properties to specific receptor subtypes. For researchers focusing on neuroinflammation, computational methods that incorporate blood-brain barrier permeability predictions are particularly valuable. These in silico approaches should be integrated with experimental validation using the recombinant rat PGD2 receptor bioassays described earlier. The computational identification of selective compounds that differentiate between DP1 and DP2 receptors is especially promising for therapeutic development, as these receptor subtypes have distinct cellular distributions (DP1 in microglia, DP2 in neurons) and likely differential roles in neuroinflammatory processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.