Recombinant Rat Prostaglandin D2 receptor (Ptgdr)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Recombinant Production

Gene and Protein Characteristics
Ptgdr is encoded by the Ptgdr gene in rats, which shares structural homology with human PTGDR. The receptor consists of 359 amino acids (human homolog) and contains seven transmembrane domains typical of GPCRs . Recombinant Ptgdr is produced in various systems, including E. coli, mammalian cells (e.g., HEK293), and wheat germ .

Primary Functions

  • Mast Cell Maturation: Ptgdr promotes mast cell maturation and degranulation via PLA2G3-dependent pathways .

  • Inflammatory Response: Mediates PGD2-induced vasodilation and leukocyte recruitment .

  • Neurological Roles: While not directly implicated in Alzheimer’s disease (AD), PGD2 signaling through DP2 receptors has been studied in AD models .

Signaling Mechanism
Ptgdr couples with G<sub>s</sub> proteins, activating adenylate cyclase to elevate intracellular cAMP. Calcium mobilization occurs without IP<sub>3</sub> production . This pathway contrasts with DP2 receptor signaling, which involves G<sub>i</sub> proteins and reduced cAMP .

Recombinant Applications in Research

Measurement and Analysis Tools
The Rat Prostaglandin D2 Receptor ELISA Kit (Assay Genie) enables precise quantification of Ptgdr in serum, plasma, and cell culture supernatants .

ParameterSpecification
Detection Range0.78–50 ng/mL
Sensitivity0.33 ng/mL
Intra-Assay CV4.2%
Inter-Assay CV8.4%
Sample TypesSerum, plasma, tissue homogenates, cell culture supernates

Use Cases

  • Inflammatory Disease Research: Ptgdr is a biomarker for asthma-related traits and allergic responses .

  • Functional Studies: Recombinant Ptgdr is used in binding assays to study PGD2 interactions .

Research Findings and Disease Associations

Asthma and Allergy
Genetic variations in Ptgdr are linked to asthma susceptibility (ASRT1) . Ptgdr’s role in mast cell activation underscores its therapeutic potential in allergic diseases .

Neurological Insights
While Ptgdr itself is not directly studied in Alzheimer’s, PGD2 levels in rat hippocampi are 14.5-fold higher than PGE2, suggesting broader PGD2 pathway involvement in neuroinflammation . DP2 receptor antagonists (e.g., timapiprant) reduce AD pathology in transgenic rats, highlighting PGD2’s dual roles in health and disease .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ptgdr; Prostaglandin D2 receptor; PGD receptor; PGD2 receptor; Prostanoid DP receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ptgdr
Target Protein Sequence
MNESYRCQAATWVERGSSATMGGVAFSAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF YVLVCGLTVTDLLGKCLISPMVLAAYAQNRSLKELLPASGNQLCEAFAFLMSFFGLASTL QLLAMALECWLSLGHPFFYQRHITARRGVLVAPVAGAFSLAFCALPFAGFGKFVQYCPGT WCFIQMIHKKRSFSVIGFSVLYSSLMALLVLATVVCNLGAMSNLYAMHRRQRHHPRRCSR DRAQSGSDYRHGSPNPLEELDHFVLLALTTVLFTMCSLPLIYRAYYGAFKLVDRADGDSE DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKTFTRPLIYRNWCSHSWQTNMESTL
Uniprot No.

Target Background

Function
The prostaglandin D2 receptor (PTGDR), also known as DP1, is a G protein-coupled receptor (GPCR) that binds prostaglandin D2 (PGD2). Its primary signaling pathway involves activation of G(s) proteins, which stimulate adenylate cyclase, leading to an increase in intracellular cyclic adenosine monophosphate (cAMP). PTGDR activation also results in calcium mobilization, but without the production of inositol 1,4,5-trisphosphate. PTGDR plays a crucial role in the maturation of mast cells through a mechanism involving phospholipase A2 group III (PLA2G3). PLA2G3 is secreted by immature mast cells and acts on nearby fibroblasts to synthesize PGD2 via prostaglandin D2 synthase (PTDGS). This PGD2, in turn, promotes mast cell maturation and degranulation via PTGDR.
Gene References Into Functions
  1. The inhibitory effect of PGD(2) in the small intestine is mediated via activation of the DP1 receptor. PMID: 18212515
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Strongly expressed in eye and gastrointestinal tract (GIT), moderately in the brain and oviduct and weakly in the epididymis. In the eye, expressed in the epithelium of the iris and ciliary body and in photoreceptor cells of the retina. In the brain, expr

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.