Recombinant Rat Prostaglandin E2 receptor EP2 subtype (Ptger2)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene & Protein Features

  • Gene location: Chromosome 15p14 in rats (Rattus norvegicus)

  • Protein structure:

    • 357 amino acids

    • 7 transmembrane domains (class A GPCR)

    • UniProt ID: Q62928

PropertyDetail
Molecular Weight~53 kDa
Expression SystemE. coli in vitro system
TagN-terminal 10xHis-tag
Storage Stability-20°C (short-term); -80°C (long-term)

Signaling Pathways

  • Primary mechanism: Gαs-mediated cAMP-PKA activation

    • Elevates intracellular cAMP → activates CREB for neuroplasticity and survival

    • Engages β-arrestin/Src pathways for EGFR transactivation (tumorigenesis)

  • Alternative pathways:

    • PI3K-Akt → inhibits GSK-3β → β-catenin nuclear translocation (colorectal cancer)

    • Epac/Rap → chronic inflammation

Ligand Interactions

  • Endogenous agonist: Prostaglandin E2 (PGE2)

  • Selective agonists:

    • Butaprost (EC₅₀ = 0.3 μM)

    • CP-533536 (non-prostanoid)

  • Antagonists:

    • PF-04418948 (pK<sub>B</sub> = 8.3 in rats)

    • TG4-155 (dual EP2/DP1 inhibitor)

Neuroinflammation Studies

  • EP2 activation exacerbates neurotoxicity in chronic models (e.g., Alzheimer’s, epilepsy) via cAMP/Epac pathways .

  • Genetic ablation reduces Aβ plaque burden and enhances microglial phagocytosis in Alzheimer’s models .

Cancer Biology

  • Promotes tumor cell migration and proliferation via:

    • β-arrestin/JNK → Profilin-1/F-actin reorganization

    • PI3K-Akt → colorectal cancer growth

Immune Modulation

  • Suppresses Treg differentiation via cAMP/PKA, suggesting therapeutic potential in rheumatoid arthritis .

Key Research Findings

  1. Dual Role in Neuroprotection/Neurotoxicity:

    • Acute EP2 activation protects against excitotoxicity via PKA-CREB .

    • Chronic activation worsens neuroinflammation through Epac .

  2. Cancer Progression:

    • EP2-driven EGFR transactivation accelerates tumor cell proliferation (e.g., lung, colorectal cancers) .

  3. Immune Regulation:

    • EP2 antagonism reduces oxidative stress in Alzheimer’s models and enhances α-synuclein clearance .

Technical Considerations for Recombinant Ptger2

  • Purity: >90% by SDS-PAGE

  • Functional assays:

    • cAMP accumulation (Gs-coupled activity)

    • Radioligand binding (³H-PGE2 displacement)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand that specific needs may arise. Should you require a particular format, please specify it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure the contents settle to the bottom. For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. To facilitate long-term storage at -20°C/-80°C, we advise adding 5-50% glycerol (final concentration) and aliquotting the solution. Our default final glycerol concentration is 50%, serving as a reference point for customers.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same temperature conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is essential. Minimize freeze-thaw cycles to preserve product integrity.
Tag Info
Tag type is determined during the manufacturing process.
We typically select the tag type during production. If you have a specific tag preference, please inform us, and we will prioritize development with that tag type.
Synonyms
Ptger2; Prostaglandin E2 receptor EP2 subtype; PGE receptor EP2 subtype; PGE2 receptor EP2 subtype; Prostanoid EP2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MDNSFNDSRRVENCESRQYLLSDESPAISSVMFTAGVLGNLIALALLARRWRGDTGCSAG SRTSISLFHVLVTELVLTDLLGTCLISPVVLASYSRNQTLVALAPESRACTYFAFTMTFF SLATMLMLFAMALERYLAIGHPYFYRRRVSRRGGLAVLPAIYGVSLLFCSLPLLNYGEYV QYCPGTWCFIQHGRTAYLQLYATVLLLLIVAVLGCNISVILNLIRMQLRSKRSRCGLSGS SLRGPGSRRRGERTSMAEETDHLILLAIMTITFAVCSLPFTIFAYMDETSSRKEKWDLRA LRFLSVNSIIDPWVFVILRPPVLRLMRSVLCCRTSLRAPEAPGASCSTQQTDLCGQL
Uniprot No.

Target Background

Function
The Prostaglandin E2 receptor subtype EP2 (PTGER2) serves as a receptor for prostaglandin E2 (PGE2). Its activity is mediated through G(s) proteins, which stimulate adenylate cyclase. The resulting increase in intracellular cAMP is responsible for the receptor's relaxing effect on smooth muscle.
Gene References Into Functions
  1. EP2 plays a role in generating mechanical hyperalgesia through a positive feedback mechanism, upregulating COX-2 expression in muscle after lengthening contractions. PMID: 28759126
  2. These findings suggest that EP2 activation, while initially promoting microglial activation, subsequently leads to delayed death of activated microglia, potentially contributing to the resolution phase of neuroinflammation. PMID: 25715797
  3. Within the spinal cord, one day following painful joint injury, there is an increased expression of prostaglandin E2 receptor. PMID: 24253784
  4. Elastogenesis is spatially regulated by PGE-EP4 signaling within the ductus arteriosus. PMID: 24146253
  5. Data indicate that painful cervical facet joint distraction induces an immediate and sustained increase in prostaglandin E2 (PGE2) receptor EP2 expression within the dorsal root ganglion (DRG). PMID: 22789984
  6. EP2 receptor signaling pathways regulate the classical activation of microglia. PMID: 23404506
  7. EP2 receptors are expressed in forebrain neurons and are induced in endothelial cells following hypoxic-ischemic injury in neonatal rats. Activation via misoprostol reduces the extent of injury. PMID: 21939736
  8. EP(4), and to a lesser extent EP(2), receptors mediate the dilatory effect of PGE(2) within the craniovascular system of rats. PMID: 20713561
  9. It is suggested that PGE(2) regulates inflammatory mediators in activated microglia via the EP2-cAMP signaling pathway under hypoxic conditions. PMID: 19712723
  10. EP2 receptor, cAMP, and PKA constitute critical components of the signaling cascade between mechanical strain and gap junction-mediated communication among osteocytes. PMID: 12939279
  11. EP2 receptor-selective agonists stimulate new bone formation on trabecular, endocortical, and periosteal surfaces, enhancing fracture healing. PMID: 14606517
  12. EP2 expression at the implantation site may play a significant role during embryo implantation. PMID: 16136483
  13. A brief 3-minute cerebral ischemia and a subsequent lethal ischemia (following a 3-minute ischemia) enhance the expression of EP2 and EP4 receptors in CA1 pyramidal neurons of the hippocampus. PMID: 16437207
  14. This data can contribute to a deeper understanding of PGE(2)'s role in normal brain function and its involvement in neuroinflammatory processes. PMID: 16546360
  15. EP2 receptor stimulation triggers cyclic AMP production but also causes the release of Ca2+ from intracellular stores. PMID: 17058034
  16. EP(2) and EP(4) receptor signaling inhibits ethanol-induced gastric mucosal injury by counteracting collecting venule constriction through a reduction in LTC(4) production. PMID: 17947453
  17. The EP(4) receptor subtype serves as the primary mediator of PGE(2)-induced electrogenic ion secretion, with a lesser degree of induction through the EP(2) receptor subtype. PMID: 18684231
  18. PGE(2) receptor types are present in the retina of rat pups and remain functional when the retina is cultured. Activation of EP2 receptors with butaprost attenuates the insult caused by insufficient serum, which may occur in situ due to reduced trophic support. PMID: 19524109
  19. PGE2 action at microglial EP2 receptors inhibits the production of the cholinergic differentiating cocktail by microglia. PMID: 19555672

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Prostaglandin E2 receptor EP2 subtype (Ptger2)?

Prostaglandin E2 receptor EP2 subtype (Ptger2) is a G protein-coupled receptor that specifically binds prostaglandin E2 (PGE2). This receptor's activity is mediated by G(s) proteins that stimulate adenylate cyclase, leading to increased intracellular cAMP levels. The subsequent elevation in cAMP is responsible for various physiological effects, including smooth muscle relaxation . EP2 receptor has emerged as a crucial mediator of many physiological and pathological events, including inflammation, synaptic transmission, cognitive function, and tumor progression .

What are the primary signaling pathways associated with EP2 receptor activation?

The EP2 receptor activates multiple signaling pathways that contribute to its diverse biological functions:

  • cAMP/PKA pathway: Upon PGE2 binding, EP2 activates Gs proteins, stimulating adenylate cyclase to increase intracellular cAMP. This activates protein kinase A (PKA), which can phosphorylate CREB, a transcription factor important for long-term potentiation (LTP) and memory formation .

  • cAMP/Epac pathway: EP2 activation can signal through this pathway, particularly in chronic inflammation contexts .

  • β-arrestin-dependent pathway: EP2 receptor can recruit β-arrestin 1 in a G protein-independent pathway that promotes tumor cell growth and migration. This occurs through phosphorylation of Src, which activates EGFR, leading to activation of PI3K/Akt and Ras/ERK pathways .

  • βγ subunit-mediated signaling: The βγ subunits liberated upon Gsα activation can directly stimulate PI3K/Akt signaling, leading to phosphorylation and inactivation of GSK-3β, causing nuclear translocation of β-catenin to initiate growth-promoting gene expression .

How does EP2 receptor signaling differ from EP4 receptor signaling in rats?

While both EP2 and EP4 receptors are coupled to Gs proteins and increase cAMP levels, they exhibit important functional differences:

ParameterEP2 ReceptorEP4 Receptor
EC50 for PGE2-induced cAMP accumulation1.3 nmol/L17 nmol/L
Response to CP-533,536Active (EC50 = 3.0 nmol/L)No response up to 10 μmol/L
Tissue distributionUbiquitous including urethral tissueVariable expression

These differences indicate that EP2 has approximately 13-fold higher sensitivity to PGE2 compared to EP4, and selective agonists like CP-533,536 can effectively distinguish between these receptor subtypes in experimental settings .

What are the most effective methods for detecting EP2 receptor expression in rat tissues?

Several complementary approaches can be employed for robust detection of EP2 receptor expression:

  • Immunohistochemistry (IHC): Use of specific antibodies such as rabbit monoclonal anti-Prostaglandin E Receptor EP2/PTGER2 (clone EPR8030(B)) which has been validated for rat samples. The protocol typically involves overnight incubation with primary antibody at 4°C, followed by rabbit secondary antibody (30 min), avidin–biotin complex conjugate (30 min), diaminobenzidine (5 min), and methyl-green counterstain .

  • Western blotting: For quantitative assessment of EP2 protein levels in tissue homogenates, using validated antibodies such as EPR8030(B) .

  • RT-PCR/qPCR: For measurement of Ptger2 mRNA expression levels.

  • Flow cytometry: For detection of EP2 expression in isolated cells or cell suspensions using fluorescently labeled antibodies .

  • Functional assays: Measuring cAMP accumulation in response to selective EP2 agonists can provide indirect evidence of receptor expression and activity .

How can recombinant rat EP2 receptor be effectively expressed in cell culture systems?

Though the search results don't provide a detailed protocol, Chinese hamster ovary (CHO-K1) cells have been successfully used to express functional rat EP2 receptors . Based on standard practices for recombinant receptor expression:

  • Vector selection: Use mammalian expression vectors containing strong promoters (CMV, EF1α) for efficient expression.

  • Transfection method: Lipid-based transfection reagents or electroporation can be effective for CHO-K1 cells.

  • Selection strategy: Include antibiotic resistance markers (G418, hygromycin) for stable cell line generation.

  • Functional validation: Confirm expression through cAMP accumulation assays using PGE2 or selective EP2 agonists such as CP-533,536 .

  • Expression verification: Employ Western blotting or immunofluorescence with specific antibodies to confirm protein expression and localization.

What experimental models are most appropriate for studying EP2 receptor function in vivo?

Several experimental models have proven valuable for investigating EP2 receptor function:

  • Genetic models: EP2 receptor knockout mice have provided insights into the physiological and pathological roles of EP2 signaling .

  • Pharmacological models:

    • Rat urethral tissue models for studying EP2-mediated relaxation responses

    • Anesthetized rat models for measuring urethral perfusion pressure changes in response to EP2 agonists

  • Disease models:

    • Collagen-induced arthritis (CIA) models to study EP2's role in joint inflammation

    • Inflammatory bowel disease (colitis) models to investigate intestinal inflammation

    • UV-induced acute skin inflammation models

    • Neuroinflammatory and neurodegenerative disease models

    • Cancer models, particularly colorectal cancer and neuroblastoma

How does EP2 receptor signaling contribute to neurological function and disorders?

EP2 receptor signaling exhibits a complex dual role in the central nervous system:

  • Neuroprotective effects: In acute models of excitotoxicity, EP2 activation can provide neuroprotection via cAMP/PKA signaling pathways .

  • Synaptic plasticity: EP2 receptors regulate synaptic transmission and cognitive function. EP2 receptor knockdown via RNA interference decreases long-term potentiation (LTP) in rat visual cortex. Upon theta-burst stimulation, Gs-coupled EP2 receptor translocates from cytosol to postsynaptic membrane, enhancing postsynaptic cAMP/PKA signaling, which activates CREB, a transcription factor crucial for LTP and memory formation .

  • Neuroinflammation: Conversely, in chronic inflammatory conditions, EP2 activation can accentuate neuroinflammation through the cAMP/Epac pathway, potentially contributing to delayed neurotoxicity .

  • Receptor trafficking: EP2 receptor trafficking mimics that of AMPA-type glutamate receptors during LTP expression, suggesting a coordinated mechanism for modulating synaptic strength .

What is the role of EP2 receptor signaling in cancer progression?

EP2 receptor signaling promotes cancer progression through multiple mechanisms:

  • Tumor cell proliferation: EP2 activation initiates G protein-dependent and -independent signaling cascades that stimulate cell proliferation .

  • β-arrestin-mediated pathways: Upon PGE2 stimulation, EP2 recruits β-arrestin 1 to phosphorylate Src, activating EGFR and downstream PI3K/Akt and Ras/ERK pathways, promoting tumor cell activities .

  • GSK-3β/β-catenin signaling: The βγ subunits released upon Gsα activation can directly stimulate PI3K/Akt signaling, leading to phosphorylation and inactivation of GSK-3β, causing nuclear translocation of β-catenin to initiate growth-promoting gene expression in colorectal cancer .

  • Cell migration: β-arrestin 1 also phosphorylates JNK, which upregulates Profilin-1 (Pfn-1), increasing F-actin expression and organization, thus promoting tumor cell migration .

  • Clinical associations: PTGER2 overexpression in colorectal cancer is associated with specific molecular features, including MSI-high status . The PGE2/EP2 signaling pathway also contributes to neuroblastoma malignancy, suggesting it as a potential therapeutic target .

How does EP2 receptor signaling influence inflammatory processes?

EP2 receptor plays crucial roles in various inflammatory conditions:

  • Th17 differentiation: PGE2 signaling through EP2 exacerbates inflammation by increasing IL-23 expression and reducing IL-12/IL-27, which together cause T cells to differentiate to Th17 effectors in inflammatory bowel disease and collagen-induced arthritis .

  • Cytokine expression: PGE2, together with IL-1β and IL-23, facilitates Th17 cell differentiation and cytokine expression mainly through EP2 and cAMP signaling .

  • Skin inflammation: PGE2 signaling via EP2 receptors regulates UV-induced acute skin inflammation by increasing skin microenvironmental blood flow .

  • Anti-inflammatory therapies: Modulation of EP2 receptor signaling is emerging as a therapeutic alternative to non-steroidal anti-inflammatory drugs (NSAIDs) for treating cyclooxygenase-2 (COX-2)-governed pathological conditions .

What are the optimal conditions for studying EP2 receptor-mediated cAMP responses?

Effective measurement of EP2 receptor-mediated cAMP responses requires careful experimental design:

  • Cell models: Chinese hamster ovary (CHO-K1) cells expressing rat EP2 receptors provide a clean system for studying receptor-specific responses .

  • Agonist concentrations:

    • PGE2: Effective concentration range of 0.1-100 nM, with EC50 of approximately 1.3 nM for rat EP2

    • CP-533,536 (selective EP2 agonist): Effective range of 0.1-100 nM, with EC50 of approximately 3.0 nM

  • Assay methods:

    • Direct measurement of cAMP accumulation in cell lysates or tissues

    • ELISA-based detection systems

    • Fluorescence-based live-cell reporters for real-time monitoring

  • Data analysis: Concentration-response curves should be generated to determine EC50 values and maximum response magnitudes .

What selective EP2 receptor agonists and antagonists are available for rat studies?

The limited selection of selective EP2 tools underscores the need for careful experimental design:

CompoundTypeSelectivityEC50 (Rat EP2)Activity on EP4
CP-533,536AgonistEP2-selective3.0 nMNo effect up to 10 μM
PGE2Endogenous agonistNon-selective1.3 nMActive (EC50 = 17 nM)

CP-533,536 represents a valuable tool for studying EP2-specific effects, as it increases cAMP accumulation in cells expressing rat EP2 receptors but has no effect on cells expressing EP4 receptors even at high concentrations .

What is the role of EP2 receptors in smooth muscle function?

EP2 receptor activation produces important effects on smooth muscle:

  • Urethral function: Both PGE2 and selective EP2 agonist CP-533,536 produce concentration-dependent relaxation and increase cAMP levels in rat urethral tissues. In anesthetized rats, these compounds dose-dependently decrease urethral perfusion pressure .

  • Mechanism of action: The relaxant response of rat urethral tissue to PGE2 and CP-533,536 occurs via stimulation of EP2 receptors and appears to be mediated by cAMP-dependent mechanisms .

  • Physiological significance: These findings suggest that EP2 receptor signaling plays an important role in urethral function and potentially in urinary tract physiology .

How should EP2 receptor expression be quantified in immunohistochemical studies?

Accurate quantification requires standardized methods:

  • Expression scoring: In published studies, PTGER2 positivity has been defined as cytoplasmic overexpression in ≥50% of tumor cells compared to normal epithelial cells, which typically show weak cytoplasmic PTGER2 expression .

  • Observer validation: For reliability, immunohistochemical markers should be interpreted by multiple investigators blinded to other data. Published concordance rates between observers for PTGER2 scoring are approximately 0.84 (κ=0.69), indicating substantial agreement .

  • Validation approach: When no established cutoff exists, one approach is to use associated molecular features (such as MSI status) to determine a biologically relevant cutoff for positivity .

  • Control tissues: Always include appropriate positive and negative controls, and compare expression to normal adjacent tissue .

What are the key considerations when developing recombinant rat EP2 receptor constructs?

When designing recombinant constructs:

  • Sequence verification: Ensure the construct contains the complete coding sequence for rat Ptger2 without mutations.

  • Epitope tagging: Consider adding epitope tags (His, FLAG, HA) to facilitate detection, but verify that tags do not interfere with receptor function.

  • Signal peptide: Maintain the native signal peptide for proper membrane targeting.

  • Fusion reporters: GFP or luciferase fusions may be useful for localization or functional studies but may alter receptor trafficking.

  • Expression system compatibility: Optimize codon usage for the intended expression system.

  • Functional validation: Always verify that the recombinant receptor maintains natural ligand binding and signaling properties .

How can researchers address contradictory findings regarding EP2 receptor function?

Given the complexity of EP2 signaling, apparent contradictions in research findings require careful consideration:

  • Contextual differences: EP2 receptor can have opposing effects depending on acute versus chronic activation. In the brain, it mediates neuroprotection in acute excitotoxicity models but may contribute to neuroinflammation in chronic conditions .

  • Signaling pathway divergence: Different experimental conditions may favor distinct signaling pathways (cAMP/PKA vs. cAMP/Epac vs. β-arrestin-dependent), leading to different functional outcomes .

  • Tissue-specific effects: EP2 function may vary substantially between tissues due to differences in receptor density and the presence of various downstream effectors .

  • Species differences: While there is conservation across species, subtle differences in EP2 structure and function may exist between rats, mice, and humans .

  • Methodological considerations: Experiments using genetic ablation versus pharmacological approaches may yield different results due to compensatory mechanisms in knockout models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.