Recombinant Rat Prostasin (Prss8)

Shipped with Ice Packs
In Stock

Description

Introduction

Prostasin, also known as channel-activating protease 1 (CAP1), is a serine protease encoded by the PRSS8 gene . It is a membrane-anchored, trypsin-like serine peptidase that is widely expressed in epithelial tissues and plays essential roles in epithelial physiology, development, and homeostasis . Studies in mice have revealed prostasin's essential role in terminal epidermal differentiation and postnatal survival .

Gene and Protein Structure

The PRSS8 gene encodes for prostasin, a protein containing a catalytic histidine-aspartate-serine triad . The serine residue within this triad is essential for prostasin's catalytic activity .

Expression and Function

Prostasin is expressed in various tissues, including the bladder epithelium, where its mRNA expression can be downregulated by lipopolysaccharide (LPS) treatment . It plays a crucial role in activating the epithelial sodium channel (ENaC) by cleaving gamma subunits . Prostasin is also regulated by aldosterone in the kidney, and urinary excretion of prostasin is increased in aldosterone-infused rats and patients with primary aldosteronism . Furthermore, prostasin may function as a tumor invasion suppressor, as it inhibits prostate and breast cancer cell invasion in vitro .

4.2. Prostasin Expression in Mouse Bladder Epithelium

Prostasin is expressed in the urothelial cells of the bladder, with intense staining in multiple layers of the transitional urothelium . Mouse bladder prostasin mRNA expression is downregulated in LPS-treated mice .

The following table illustrates the impact of LPS injection on mouse prostasin mRNA expression in the bladder :

Experiment GroupGene EvaluatedExpression Level Normalized to GAPDHChange vs. Control (Fold)
FVB (saline injected)Mouse prostasin9.04±0.35×10 −21.0
FVB/LPSMouse prostasin2.57±0.33×10 −20.28 a
47870/LPSMouse prostasin4.29±0.43×10 −21.67 b
47879/LPSMouse prostasin3.84±0.42×10 −21.49 b

Values are means ± SE. Experimental groups are as indicated: control (FVB, n = 5), LPS-treated FVB (FVB/LPS, n = 9), and LPS-treated transgenic mice (47870/LPS, n = 6, and 47879/LPS, n = 8).

Statistical difference (P< 0.05) between the FVB and the FVB/LPS data groups for bladder mouse prostasin mRNA expression.

Statistical difference (P< 0.05) between the 47870/LPS or the 47879/LPS, and the FVB/LPS data groups for bladder mouse prostasin mRNA expression.

4.3. Role in Sodium Transport

Prostasin regulates the epithelial sodium channel (ENaC), which is critical for sodium and water absorption in various tissues, including the lungs and intestines .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Prss8; Prostasin; Channel-activating protease 1; CAP1; Serine protease 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-322
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Prss8
Target Protein Sequence
ITGGGSAKPGQWPWQVSITYNGVHVCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQ LDSFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPN GLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCA GYVKGGKDACQGDSGGPLSCPIDGLWYLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHH VAELQPRVVPQTQESQPDGHLCNHHPVFNLAAAQKLSR
Uniprot No.

Target Background

Function
Recombinant Rat Prostasin (Prss8) exhibits trypsin-like cleavage specificity, preferentially targeting poly-basic substrates. It stimulates epithelial sodium channel (ENaC) activity by activating the cleavage of its gamma subunits (SCNN1G).
Gene References Into Functions
  1. Mutations in the CAP1/Prss8 serine protease gene reduce embryonic viability, cause skin defects, and decrease ENaC activity. PMID: 22705055
  2. Studies indicate that apical, GPI-anchored, lipid raft-associated serine protease activity, consistent with prostasin, is crucial for the development of a high-resistance collecting duct epithelium. PMID: 20645929
  3. A 12-bp deletion in Prss8 exon 3 is responsible for the 'hairless', frizzy-Charles River (frCR) phenotype. No Prss8 coding sequence alterations were found in the allelic 'fuzzy' rat variant. PMID: 20201958
Database Links
Protein Families
Peptidase S1 family
Subcellular Location
Cell membrane; Single-pass membrane protein.; [Prostasin]: Secreted, extracellular space.; [Prostasin light chain]: Secreted, extracellular space.; [Prostasin heavy chain]: Secreted, extracellular space.

Q&A

What is Prostasin/Prss8 and what are its key molecular characteristics?

Prostasin (PRSS8), also known as channel activating protease 1, is a serine protease with trypsin-like substrate specificity . It is a membrane-anchored protein that can exist in both membrane-bound and secreted forms. The protein is approximately 40 kDa when detected under reducing conditions by Western blot . Prostasin is synthesized as a membrane protein that may be quickly cleaved by cellular mechanisms and released into the extracellular medium, explaining why it is often detected predominantly in culture media rather than membrane or cytosolic fractions in certain cell types . The protein contains a catalytic histidine-aspartate-serine triad that is essential for its enzymatic activity, though interestingly, some of its biological functions can be mediated through non-catalytic mechanisms .

How does rat Prostasin/Prss8 compare structurally and functionally to mouse and human orthologs?

While the search results don't provide direct comparative data between rat, mouse, and human Prostasin/Prss8, several inferences can be made based on available information. Mouse prostasin cDNA was originally cloned using degenerate primers corresponding to human prostasin amino acid sequences, suggesting significant sequence homology between species . Both human and mouse prostasin share similar molecular weights (approximately 40 kDa) and functional properties. Research approaches used across species are similar, indicating conserved functional domains. The catalytic triad is highly conserved across species, as evidenced by similar experimental approaches in functional studies. When designing experiments using rat Prostasin/Prss8, researchers should consider that while core functions are likely conserved, species-specific differences may exist in regulatory mechanisms, post-translational modifications, and interaction partners.

What are the known tissue expression patterns of Prostasin/Prss8?

Prostasin/Prss8 demonstrates distinct tissue-specific expression patterns. It was originally identified in the prostate, where it exists in both secreted and glycosylphosphatidylinositol (GPI)-anchored forms . In kidney tissue, Prostasin/Prss8 expression is regulated by aldosterone and plays important roles in epithelial function . The protein has been detected in pancreatic islets, specifically in β-cells, where it contributes to insulin secretion regulation . Prostasin/Prss8 is also expressed in the epidermis, where it plays a crucial role in terminal differentiation and barrier formation . Research using antibody-based detection methods has shown specific cytoplasmic staining patterns in tissues such as human prostate, confirming protein localization . The varied expression pattern across tissues correlates with its diverse physiological functions in epithelial barrier regulation, ion channel modulation, and hormone secretion.

What are the optimal conditions for expressing and purifying recombinant Prostasin/Prss8?

Based on established protocols for recombinant protein production, optimal expression and purification of Rat Prostasin/Prss8 typically involves:

  • Expression System Selection: Mammalian expression systems (such as HEK293 or CHO cells) are preferable for maintaining proper post-translational modifications and folding of Prostasin/Prss8.

  • Vector Construction: The full-length cDNA sequence should be cloned into an appropriate expression vector. For example, PCR amplification of the coding sequence can be performed using specific primers with appropriate restriction enzyme sites (such as HindIII and EcoRI) as demonstrated in protocols for mouse prostasin .

  • Purification Strategy: A multi-step purification approach is typically employed:

    • Initial capture using affinity chromatography (if tagged)

    • Further purification via ion exchange chromatography

    • Final polishing step using size exclusion chromatography

  • Buffer Optimization: For enzymatic activity preservation, buffers containing 50 mM Tris with 0.05% (w/v) Brij-35 at pH 9.0 have been successfully used for recombinant mouse Prostasin/Prss8 .

  • Quality Assessment: Verification of purity and activity through SDS-PAGE analysis and enzymatic activity assays using specific substrates like BOC-Gln-Ala-Arg-AMC .

How can I accurately measure Prostasin/Prss8 enzymatic activity in experimental samples?

A standardized fluorogenic assay can be used to accurately measure Prostasin/Prss8 enzymatic activity:

Materials Required:

  • Assay Buffer: 50 mM Tris, 0.05% (w/v) Brij-35, pH 9.0

  • Recombinant Prostasin/Prss8

  • Substrate: BOC-Gln-Ala-Arg-AMC

  • F16 Black Maxisorp Plate

  • Fluorescent Plate Reader capable of excitation at 380 nm and emission at 460 nm

Procedure:

  • Dilute recombinant Prostasin/Prss8 to 20 μg/mL in Assay Buffer

  • Prepare Substrate at 200 μM in Assay Buffer

  • Combine 50 μL of diluted protein with 50 μL of Substrate in a black well plate

  • Include a Substrate Blank (50 μL Assay Buffer + 50 μL Substrate)

  • Measure fluorescence at excitation 380 nm and emission 460 nm in kinetic mode for 5 minutes

  • Calculate specific activity using the formula provided for pmoles of substrate cleaved

Data Analysis:

  • Plot fluorescence vs. time

  • Calculate the rate of fluorescence increase (slope)

  • Convert to enzymatic activity using appropriate calibration standards

  • Express results as pmol/min/μg protein

What are effective strategies for detecting Prostasin/Prss8 expression in tissue samples?

Several complementary approaches can be employed for robust detection of Prostasin/Prss8 in tissue samples:

Western Blot Analysis:

  • Sample Preparation:

    • For tissue samples: Prepare lysates in appropriate lysis buffer

    • For secreted prostasin: Concentrate culture media using TCA precipitation

    • Load 20-80 μg protein per lane

  • Optimized Protocol:

    • Use PVDF membrane for protein transfer

    • Probe with specific anti-Prostasin/Prss8 antibody (e.g., 2 μg/mL)

    • Follow with appropriate HRP-conjugated secondary antibody

    • Detect specifically at approximately 40 kDa under non-reducing conditions

Immunohistochemistry (IHC):

  • Tissue Processing:

    • Use immersion-fixed paraffin-embedded sections

    • Optimize antigen retrieval methods

  • Staining Protocol:

    • Incubate with anti-Prostasin/Prss8 antibody (e.g., 15 μg/mL) overnight at 4°C

    • Use appropriate detection system (e.g., HRP-DAB)

    • Counterstain with hematoxylin

    • Include negative controls (omitting primary antibody)

RT-PCR and qPCR:

  • Design specific primers based on rat Prostasin/Prss8 sequence

  • For full-length cDNA cloning, consider RACE approaches as demonstrated for mouse prostasin

  • Include appropriate housekeeping genes for normalization

How does Prostasin/Prss8 contribute to epithelial barrier function and what experimental models best demonstrate this?

Prostasin/Prss8 plays a critical role in epithelial barrier function through multiple mechanisms:

Mechanistic Contributions:

  • Regulation of epithelial sodium channels (ENaC) through proteolytic activation

  • Maintenance of tight junction integrity and epithelial resistance

  • Support of terminal epidermal differentiation through both catalytic and non-catalytic functions

Experimental Models:

  • Genetic Mouse Models:

    • Prss8−/− knockout mice: These mice lack barrier formation and display fatal postnatal dehydration

    • Prss8Cat−/Cat− mice: Contain a point mutation rendering prostasin catalytically inactive, yet interestingly develop normal barrier function

  • Cell Culture Systems:

    • Kidney epithelial cell monolayers for studying transepithelial electrical resistance (TER)

    • Measurement of epithelial permeability using labeled dextrans of various molecular weights

  • Skin Barrier Assessment:

    • Transepidermal water loss measurements

    • Dye penetration assays

    • Histological analysis of differentiation markers

The striking difference between the phenotypes of complete Prostasin/Prss8 knockout versus catalytically inactive Prostasin/Prss8 mutant mice suggests that some essential functions in epithelial barrier formation are mediated through non-catalytic mechanisms . This provides a fascinating research paradigm for distinguishing between enzymatic and structural roles of this protease.

What is the role of Prostasin/Prss8 in insulin secretion and glucose homeostasis?

Prostasin/Prss8 plays a significant role in glucose-stimulated insulin secretion through the following mechanisms:

Regulatory Pathways:

  • Prostasin is expressed in β-cells of pancreatic islets

  • It mediates a regulatory pathway involving the EGF-EGFR signaling axis

  • Glucose stimulation increases endogenous Prostasin/Prss8 levels in β-cells through inhibition of intracellular degradation

Experimental Evidence:
Studies with pancreatic β-cell-specific Prostasin/Prss8 knockout (βKO) and overexpressing (βTG) mice revealed:

ModelPhenotypeInsulin SecretionGlucose Tolerance
βKO miceImpaired glucose handlingReduced glucose-stimulated insulin secretionGlucose intolerance
βTG miceEnhanced glucose responseHeightened insulin secretionImproved glucose tolerance
MIN6 cells with silenced PRSS8Reduced insulin responseDecreased glucose-stimulated insulin secretionImpaired EGFR signaling
MIN6 cells overexpressing PRSS8Enhanced insulin responseIncreased basal and glucose-stimulated insulin secretionIncreased phospho-EGFR concentrations

Molecular Mechanism:

  • Prostasin regulates EGFR through proteolytic processing

  • Glucose stimulation promotes EGF release from β-cells

  • The EGF-EGFR pathway is critical for insulin secretion, as demonstrated by experiments with Erlotinib (an EGFR blocker)

These findings establish Prostasin/Prss8 as a potential therapeutic target in metabolic disorders, particularly type 2 diabetes, where enhanced insulin secretion could improve glycemic control.

How is Prostasin/Prss8 expression regulated by hormones and other signaling molecules?

Prostasin/Prss8 expression is subject to complex regulatory control by various hormones and signaling molecules:

Aldosterone Regulation:

  • Aldosterone significantly upregulates Prostasin/Prss8 expression in kidney epithelial cells

  • In vivo studies using rat models with subcutaneously implanted osmotic minipumps delivering 100 μg/100 g body weight aldosterone per day demonstrated increased prostasin expression

  • In M-1 cortical collecting duct cells, aldosterone treatment increased prostasin protein expression by 3.5-fold ± 0.6-fold and 3.3-fold ± 0.3-fold compared to controls during 24-hour and 48-hour incubations

Glucose Regulation:
Short-term exposure to glucose increases endogenous Prostasin/Prss8 concentration in pancreatic β-cells (MIN6 cells) through inhibition of intracellular degradation, establishing a feed-forward mechanism that enhances insulin secretion

Post-translational Regulation:
Prostasin/Prss8 activity is regulated by:

  • Glycosylphosphatidylinositol (GPI) anchoring to cell membranes

  • Proteolytic processing by other proteases

  • Secretion mechanisms that transition membrane-anchored forms to soluble forms

Cell-specific Expression Control:
Different cell types exhibit distinct patterns of Prostasin/Prss8 distribution. In prostate epithelial cells, both membrane-anchored and secreted forms exist, while in M-1 kidney cells, the protein is predominantly secreted into the culture medium rather than retained in membrane or cytosolic fractions .

How can I design effective genetic modifications to study Prostasin/Prss8 function in rat models?

Designing effective genetic modifications for studying Prostasin/Prss8 requires careful consideration of targeting strategies:

Gene Knockout Approaches:

  • Complete Gene Ablation:

    • CRISPR/Cas9-mediated deletion of the entire Prss8 gene

    • Note that complete knockout in mice is lethal postnatally due to epidermal barrier defects

  • Tissue-Specific Knockout:

    • Cre-loxP system targeting specific tissues (e.g., pancreatic β-cell-specific knockout as in βKO models)

    • Utilize tissue-specific promoters (e.g., insulin promoter for β-cells)

  • Inducible Knockout:

    • Tamoxifen-inducible Cre-ERT2 system to control timing of gene deletion

    • Particularly useful for studying adult phenotypes while avoiding developmental lethality

Catalytic Mutant Generation:

  • Point Mutation Strategy:

    • Introduce the S-to-A mutation in the catalytic triad (as in Prss8Cat−/Cat− mice)

    • This generates catalytically inactive protein while preserving expression and structural functions

    • Specific nucleotide substitutions should target the serine codon in the active site

  • Domain-Specific Modifications:

    • Modify GPI-anchoring site to study membrane vs. secreted forms

    • Create truncation mutants to identify functional domains

Overexpression Models:

  • Transgenic Approach:

    • Design construct with tissue-specific promoter and full-length Prss8 cDNA

    • Consider FLAG or other epitope tags for detection (e.g., insertion between amino acids 310 and 311)

  • Viral Vector Delivery:

    • AAV or lentiviral vectors for postnatal gene delivery

    • Enables spatial and temporal control of expression

Validation Methods:

  • Confirm modification at DNA level (PCR, sequencing)

  • Verify altered expression at RNA level (RT-PCR, RNA-seq)

  • Validate protein expression changes (Western blot, immunohistochemistry)

  • Assess functional consequences (enzymatic activity assays, physiological measurements)

What are the challenges in distinguishing catalytic versus non-catalytic functions of Prostasin/Prss8?

Distinguishing between catalytic and non-catalytic functions of Prostasin/Prss8 presents several methodological challenges:

Experimental Approaches:

  • Genetic Models Comparison:

    • Complete knockout (Prss8−/−) versus catalytically inactive mutant (Prss8Cat−/Cat−)

    • The striking difference in phenotypes (lethal in knockout vs. viable in catalytic mutant) provides strong evidence for non-catalytic functions

  • Selective Inhibition Strategies:

    • Pharmacological inhibitors targeting the active site

    • Antibodies that block the catalytic site versus those binding to other domains

    • Domain-specific blocking peptides

  • Structure-Function Analysis:

    • Site-directed mutagenesis of non-catalytic domains

    • Creation of chimeric proteins swapping domains with related proteases

    • Deletion mutants targeting specific structural elements

Technical Challenges:

  • Substrate Identification Complexity:

    • Difficulty in distinguishing direct from indirect effects

    • Potential compensatory mechanisms in genetic models

    • Overlapping substrate specificity with related proteases

  • Protein-Protein Interaction Detection:

    • Membrane localization complicates traditional co-immunoprecipitation

    • Need for specialized techniques for GPI-anchored protein interactions

    • Distinguishing between physical binding versus enzymatic processing

  • Temporal Dynamics:

    • Different functions may predominate during development versus adult physiology

    • Acute versus chronic effects of Prostasin/Prss8 activity or presence

Analytical Framework:

Function TypeExperimental ApproachExpected Outcome in Catalytic MutantControl/Validation
Purely CatalyticEnzymatic activity assayComplete lossActivity recovered with wild-type rescue
Purely Non-catalyticProtein-protein interactionPreservedUnaffected by active site inhibitors
Mixed MechanismPhysiological readoutPartial preservationDifferential rescue with catalytic vs. full knockout

The discovery that Prss8Cat−/Cat− mice develop normal epidermal barrier function despite lacking enzymatic activity exemplifies how comparing different genetic models can reveal non-catalytic functions .

What techniques are most effective for identifying Prostasin/Prss8 substrates and interaction partners?

Identifying the substrates and interaction partners of Prostasin/Prss8 requires a multi-faceted approach combining proteomic, biochemical, and genetic techniques:

Substrate Identification:

  • Proteomic Approaches:

    • Terminal Amine Isotopic Labeling of Substrates (TAILS)

    • Stable Isotope Labeling with Amino acids in Cell culture (SILAC) comparing wild-type vs. Prostasin/Prss8-deficient samples

    • Mass spectrometry analysis of cleaved peptides

  • Targeted Candidate Analysis:

    • In vitro cleavage assays using recombinant Prostasin/Prss8 with purified candidate substrates

    • Western blot analysis detecting substrate processing (e.g., EGFR has been identified as a substrate)

  • Cellular Assays:

    • Co-expression of Prostasin/Prss8 with epitope-tagged potential substrates

    • Monitoring substrate cleavage in cells with manipulated Prostasin/Prss8 expression

Interaction Partner Identification:

  • Affinity Purification Techniques:

    • Epitope-tagged Prostasin/Prss8 (e.g., FLAG-tagged as in pcDNA3.1-mProstasin-FLAG)

    • Pull-down assays followed by mass spectrometry

    • Cross-linking approaches for transient interactions

  • Membrane-Specific Methods:

    • Detergent-resistant membrane fractionation

    • Proximity labeling techniques (BioID, APEX)

    • Fluorescence resonance energy transfer (FRET) for live-cell interaction detection

  • Genetic Screening:

    • Yeast two-hybrid using the soluble domain of Prostasin/Prss8

    • CRISPR screens identifying genes that modify Prostasin/Prss8-dependent phenotypes

Validation Strategies:

  • Functional Validation:

    • Site-directed mutagenesis of putative cleavage sites

    • Phenotype rescue experiments

    • Pharmacological inhibition studies

  • Spatiotemporal Correlation:

    • Co-localization studies in relevant tissues

    • Synchronized expression analysis during development or physiological responses

  • In vivo Relevance:

    • Confirmation in animal models (e.g., the altered EGFR signaling observed in Prostasin/Prss8 βKO mice)

    • Correlation with physiological outcomes in genetic models

Current evidence suggests EGFR as a significant Prostasin/Prss8 substrate in pancreatic β-cells, where proteolytic shedding by Prostasin/Prss8 regulates EGFR signaling and subsequent insulin secretion .

What are common pitfalls in Prostasin/Prss8 activity assays and how can they be addressed?

Researchers frequently encounter several challenges when conducting Prostasin/Prss8 activity assays:

Challenge: Inconsistent Activity Measurements

Solutions:

  • Buffer Optimization:

    • Maintain strict pH control at 9.0, as trypsin-like serine proteases are highly pH-sensitive

    • Include 0.05% (w/v) Brij-35 to prevent protein aggregation and surface adsorption

    • Avoid thiol-containing reducing agents that can affect the catalytic cysteine residues

  • Storage Stability:

    • Aliquot enzyme preparations to avoid freeze-thaw cycles

    • Store with stabilizing excipients (e.g., glycerol, carrier proteins)

    • Monitor activity decay over time to establish reliable working periods

Challenge: Substrate Specificity Issues

Solutions:

  • Substrate Selection:

    • Use validated substrates such as BOC-Gln-Ala-Arg-AMC for Prostasin/Prss8

    • Compare multiple substrates to establish specificity profile

    • Consider substrate concentration optimization (typical working range: 50-200 μM)

  • Specificity Controls:

    • Include catalytically inactive mutant (S-to-A) as negative control

    • Use selective inhibitors to confirm specificity

    • Perform parallel assays with related proteases to establish discriminatory conditions

Challenge: Interference from Sample Matrix

Solutions:

  • Matrix Effects:

    • Perform standard additions to quantify and correct for matrix effects

    • Include appropriate blanks (sample matrix without enzyme)

    • Consider sample clean-up procedures for complex biological samples

  • Endogenous Inhibitors:

    • Screen for presence of endogenous inhibitors in samples

    • Implement size exclusion or affinity-based separation before assay

    • Validate with spike-recovery experiments

Challenge: Detection Limitations

Solutions:

  • Signal Optimization:

    • Optimize enzyme:substrate ratio for linear reaction kinetics

    • Extend measurement time for low activity samples

    • Consider signal amplification strategies for enhanced sensitivity

  • Instrument Settings:

    • Optimize fluorescence gain settings for each plate reader

    • Establish standard curves with free AMC to convert fluorescence units to absolute substrate cleavage

    • Maintain consistent temperature control (typically 25°C or 37°C)

Assay Validation Checklist:

  • Linearity with respect to enzyme concentration

  • Time-dependent progression curves

  • Substrate saturation analysis (Km determination)

  • Inhibitor dose-response relationships

  • Inter- and intra-assay coefficient of variation determination

How can I effectively troubleshoot expression and detection issues with recombinant Prostasin/Prss8?

Troubleshooting expression and detection of recombinant Prostasin/Prss8 requires systematic analysis of potential issues at each experimental stage:

Expression System Challenges:

  • Low Expression Yields:

    • Optimize codon usage for expression host

    • Test different promoters and enhancer elements

    • Evaluate secretion signal sequences

    • Consider fusion tags to enhance expression and solubility

  • Improper Post-translational Modifications:

    • Select appropriate cell lines (mammalian cells for proper glycosylation)

    • Verify GPI-anchor attachment in membrane-bound forms

    • Assess N-glycosylation status with PNGase F treatment

Purification Troubleshooting:

  • Poor Solubility:

    • Optimize lysis buffer composition (detergents for membrane-bound forms)

    • Include stabilizing agents (glycerol, specific ions)

    • Consider temperature adjustments during extraction

  • Low Recovery:

    • Test multiple affinity tags (His, FLAG, GST) for optimal purification

    • Implement multi-step purification strategy

    • Monitor proteolytic degradation during purification

Detection Challenges:

  • Western Blot Issues:

    • If no signal is detected, verify protein transfer efficiency

    • Test multiple antibodies targeting different epitopes

    • Remember that Prostasin/Prss8 appears at approximately 40 kDa under reducing conditions

    • Consider non-reducing conditions if disulfide bonds are critical

  • Activity Detection Problems:

    • Verify catalytic domain integrity

    • Test multiple fluorogenic or chromogenic substrates

    • Include positive controls (commercial proteases with similar specificity)

Troubleshooting Decision Tree:

If expression is confirmed but activity is absent:

  • Check for proper folding (CD spectroscopy)

  • Verify catalytic triad integrity (mutational analysis)

  • Assess inhibitor binding (active site titration)

  • Examine buffer compatibility (pH, salt, additives)

If expression is poor:

  • Analyze mRNA levels (qPCR)

  • Check for protein degradation (protease inhibitor panel)

  • Verify secretion vs. retention (analyze media and cell fractions separately)

  • Consider fusion with stabilizing partners

What experimental controls are essential when studying Prostasin/Prss8 in different biological systems?

Robust experimental design for studying Prostasin/Prss8 requires carefully selected controls tailored to each biological system and research question:

In Vitro Enzymatic Studies:

  • Essential Controls:

    • Substrate-only baseline (no enzyme)

    • Heat-inactivated enzyme (denaturation control)

    • Catalytically inactive mutant (S-to-A mutation)

    • Specific protease inhibitors (mechanistic validation)

  • Quantification Controls:

    • Standard curve of cleaved product (e.g., AMC standard curve)

    • Kinetic progression monitoring (linearity verification)

    • Enzyme titration series (activity proportionality)

Cell Culture Systems:

  • Expression Controls:

    • Empty vector transfection

    • Wildtype vs. catalytic mutant comparison

    • Inducible expression systems with and without inducer

    • siRNA/shRNA with scrambled sequence control

  • Localization Controls:

    • Separate analysis of membrane, cytosolic, and media fractions

    • Subcellular fraction markers for contamination assessment

    • Co-localization with known compartment markers

  • Functional Controls:

    • Pharmacological inhibitors (e.g., Erlotinib for EGFR pathway)

    • Rescue experiments in knockdown/knockout models

    • Dose-response relationships

Animal Models:

  • Genetic Model Controls:

    • Littermate wild-type controls

    • Heterozygous animals (gene dosage effects)

    • Comparison of complete knockout vs. catalytic mutant

    • Tissue-specific conditional models with Cre-negative controls

  • Physiological Readout Controls:

    • Sham-operated or vehicle-treated animals

    • Time-matched sampling

    • Sex-matched groups

    • Age-matched cohorts

  • Experimental Intervention Controls:

    • Vehicle control for aldosterone administration

    • Drug delivery method controls (e.g., empty osmotic minipumps)

    • Physiological challenge tests (e.g., glucose tolerance test controls)

Antibody-Based Detection:

  • Specificity Controls:

    • Peptide competition (antibody pre-absorption with immunizing peptide)

    • Knockout/knockdown tissue negative controls

    • Isotype control antibodies

    • Secondary antibody-only controls

  • Technical Controls:

    • Loading controls for Western blots

    • Positive control tissues with known expression

    • Gradient of recombinant protein standards

    • Cross-reactivity assessment with related proteases

Control Strategy Table:

Experiment TypePositive ControlNegative ControlSpecificity ControlTechnical Control
Activity AssayCommercial proteaseHeat-inactivated enzymeSelective inhibitorsSubstrate-only baseline
Western BlotRecombinant proteinKnockout tissuePeptide competitionLoading control (β-actin)
IHC/ICCKnown expressing tissuePrimary antibody omissionPeptide blockingIsotype control
Functional StudyGain-of-functionLoss-of-functionRescue experimentDose-response
Animal ModelWild-type littermatesSham/vehicle treatmentTissue-specific controlsAge/sex-matched groups

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.