Recombinant Rat Protein ATP1B4 (Atp1b4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Atp1b4; Protein ATP1B4; X,K-ATPase subunit beta-m; X/potassium-transporting ATPase subunit beta-m
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MRRQLRSRRAPAFPYGYRYRLDDQDEMNHNYLADEEEEAEEEAQVMMVPGLEEEEEEEEG KEEEEEREEEEGQGQSTGNAWWRKLQIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYA SLAAVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPFAHSLNFNFNVSEPETWQRYVIS LNGFLQGYNDSLQEEMNIDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYS TGQPCILLKMNRIVGFRPEFGDPVKVSCKVQKGDENDIRSINYYPESASFDLRYYPYYGK LTHVNYTSPLVAMHFTDVVKNQEVPVQCQLKGKGIVNDVINDRFVGRIIFTLNIET
Uniprot No.

Target Background

Function
ATP1B4 may function as a transcriptional coregulator during muscle development through its interaction with SNW1. It has lost its ancestral role as a Na,K-ATPase beta-subunit.
Gene References Into Functions
  1. Eutherian Atp1b4 has lost its ancestral function as a Na,K-ATPase beta-subunit and now interacts with the transcriptional coregulator Ski-interacting protein (SKIP). PMID: 17592128
Database Links
Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Nucleus inner membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in perinatal myocytes (at protein level). Expressed during postnatal development in skeletal muscle and heart.

Q&A

What is ATP1B4 and What Are Its Functions in Rats?

ATP1B4 is a protein encoded by the ATP1B4 gene that has undergone significant functional evolution in mammals. In rats, as in other eutherian (placental) mammals, ATP1B4 (also known as BetaM) is a muscle-specific protein localized to the inner nuclear membrane. Unlike in lower vertebrates where it functions as a Na,K-ATPase β-subunit in ion transport, rat ATP1B4 has evolved to regulate muscle-specific gene expression.

The protein interacts with transcriptional co-regulators such as SKI-interacting protein (SKIP) and is highly expressed during late fetal and early postnatal muscle development . Through its unique nucleoplasmic domain, rat ATP1B4 binds to regulatory regions of muscle-specific genes like MyoD, promoting epigenetic changes associated with transcriptional activation . This evolutionary transition from membrane ion transport to nuclear gene regulation represents a rare case of orthologous gene co-option.

What Expression Systems Are Most Suitable for Producing Recombinant Rat ATP1B4?

Multiple expression systems can be used for producing Recombinant Rat ATP1B4, each with specific advantages:

Expression SystemAdvantagesConsiderations for ATP1B4
E. coliRapid growth, high yield, cost-effectiveMay need optimization for solubility of full-length protein
YeastPost-translational modifications, higher eukaryotic processingModerate yield, longer production time
Baculovirus/Insect cellsMore complex post-translational modifications, better foldingHigher cost, soluble expression of full-length protein
Mammalian cellsNative-like processing and modificationsHighest cost, lower yield, best for functional studies

For ATP1B4, baculovirus/insect cell systems have been successfully used to express and purify the full-length protein to homogeneity . When using E. coli, experimental design approaches can optimize expression conditions. The recommended parameters include: growth to OD600 of 0.8, induction with 0.1 mM IPTG for 4 hours at 25°C, in media containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, and 1 g/L glucose with 30 μg/mL kanamycin . This systematic approach can yield up to 250 mg/L of soluble recombinant protein.

What Purification Strategies Are Recommended for Recombinant Rat ATP1B4?

Purifying Recombinant Rat ATP1B4 to homogeneity requires a multi-step chromatography approach. Based on successful purification strategies for similar proteins, the following protocol is recommended:

  • Initial capture using immobilized metal affinity chromatography (IMAC):

    • For His-tagged ATP1B4, use NiNTA agarose with optimized binding and elution buffers

    • Critical step for separating the target protein from the bulk of cellular proteins

  • Intermediate purification using ion-exchange chromatography:

    • Anion-exchange chromatography has been effective for ATP1B4 purification

    • Use a salt gradient for elution to separate proteins based on charge differences

  • Final polishing with affinity chromatography:

    • For dual-tagged ATP1B4 (e.g., His-FLAG), anti-FLAG immunoaffinity chromatography provides high selectivity

    • This step can achieve homogeneity, as demonstrated with similar proteins

Studies have shown that this sequential approach can yield highly pure protein with approximately 10-20 μg per liter of insect cell culture . Optimization of buffer compositions is essential throughout the purification process to maintain protein solubility and stability.

How Can Researchers Assess the Quality and Functionality of Purified Recombinant Rat ATP1B4?

A comprehensive assessment of purified Recombinant Rat ATP1B4 should include both quality control and functional analyses:

Quality Assessment:

  • Purity: SDS-PAGE under reducing and non-reducing conditions (target: ≥95% purity)

  • Identity: Western blotting using antibodies against both N-terminal and C-terminal tags

  • Homogeneity: Size exclusion chromatography to detect aggregates or oligomeric states

  • Endotoxin levels: Limulus Amebocyte Lysate (LAL) assay (target: ≤0.1 EU/μg protein)

Functional Analyses:

  • Nucleotide binding assay: ATP1B4 can bind ATP/dATP but not CTP, GTP, or UTP

  • ATPase activity assay: Using modified acidified charcoal precipitation method

  • Protein-protein interaction assays: Testing interaction with known partners like SKIP using co-immunoprecipitation or yeast two-hybrid systems

  • DNA-binding assays: EMSA to assess binding to regulatory regions such as the MyoD distal regulatory region (DRR)

For EMSA specifically, nuclear extracts should be prepared with optimal protein concentration (5-8 μg/μL), and experiments should include both wildtype and mutant oligonucleotide competition to validate binding specificity .

What Is Known About the Evolutionary Significance of ATP1B4 in Eutherian Mammals?

ATP1B4 represents a rare instance of orthologous gene co-option during vertebrate evolution, with significant implications for muscle development in eutherian mammals:

Evolutionary Transitions:

  • In lower vertebrates (fish, amphibians, birds): Functions as a Na,K-ATPase β-subunit in plasma membrane ion pumps

  • In eutherian mammals (including rats): Completely lost its ancestral function and evolved to become a muscle-specific nuclear protein involved in transcriptional regulation

Structural Changes During Evolution:

  • Addition of two extended Glu-rich clusters in the N-terminal domain

  • Acquisition of an N-terminal Arg-rich nonapeptide

  • Retention of all structural features and signature motifs of X,K-ATPase β-subunits

These evolutionary alterations resulted in localization to the inner nuclear membrane rather than the plasma membrane, with the N-terminal domain exposed to the nucleoplasm. The Glu-rich clusters form intrinsically disordered domains that likely serve as flexible molecular recognition elements in transcriptional regulation .

The eutherian-specific functions of ATP1B4 in muscle development might provide evolutionary advantages to placental mammals, potentially contributing to their remarkable diversity and success .

What Methods Can Be Used to Study the Interaction Between ATP1B4 and Transcriptional Co-regulators?

To investigate interactions between ATP1B4 and transcriptional co-regulators like SKIP, researchers can employ several complementary approaches:

Yeast Two-Hybrid (Y2H) and Split-Ubiquitin Systems:

These methods have successfully identified BetaM interactors including SKIP, LAP-1, Syne1, HMOX1, HMOX2, LZIP/CREB3, ERGIC3, PHF3, reticulocalbin-3, and β-sarcoglycan . The split-ubiquitin system is particularly useful for membrane proteins.

Co-Immunoprecipitation (Co-IP):

  • Use anti-ATP1B4 antibodies to pull down protein complexes from muscle cell/tissue lysates

  • Analyze by Western blotting or mass spectrometry to identify interacting partners

  • Can be performed in both directions (using antibodies against putative partners)

Domain Mapping:

Analysis of truncated forms of ATP1B4 has revealed that residues 72-98 in the nucleoplasmic domain adjacent to the membrane are critical for interaction with SKIP . Similar approaches can map interaction domains with other partners.

ChIP-based Approaches:

  • Chromatin Immunoprecipitation (ChIP) can determine if ATP1B4 and co-regulators co-occupy the same genomic regions

  • Sequential ChIP (re-ChIP) can confirm simultaneous binding of ATP1B4 and partners to the same DNA regions

  • ChIP-seq provides genome-wide binding profiles

Proximity Ligation Assays:

These can visualize protein-protein interactions in situ, providing spatial information about interaction sites within cells.

What Experimental Approaches Can Demonstrate ATP1B4's Role in Muscle Development?

To investigate ATP1B4's function in muscle development, researchers can employ these methodological approaches:

Gene Expression Studies in Developmental Models:

  • Analyze ATP1B4 expression patterns during rat muscle development using qRT-PCR and immunohistochemistry

  • Correlate expression with developmental stages and muscle maturation markers

Cell Culture Models:

  • Express recombinant ATP1B4 in C2C12 myoblasts and analyze effects on differentiation

  • Use RNA interference to knock down endogenous ATP1B4 and rescue with wild-type or mutant forms

  • Monitor changes in muscle-specific gene expression, particularly MyoD

Chromatin Remodeling and Epigenetic Studies:

  • ATP1B4 has been shown to bind the distal regulatory region (DRR) of MyoD and recruit the SWI/SNF chromatin remodeling subunit BRG1

  • ChIP assays can detect ATP1B4-mediated changes in histone modifications at muscle-specific gene promoters

  • Analyze changes in chromatin accessibility using techniques like ATAC-seq

DNA-binding Studies:

  • EMSA experiments have demonstrated that ATP1B4 binds to both E-box4 and CArG elements in the MyoD DRR

  • Competition EMSAs with wildtype and mutant sequences can validate binding specificity

  • DNA-protein interaction mapping can identify critical nucleotides for ATP1B4 binding

Transcriptional Reporter Assays:

  • Construct reporter plasmids containing muscle-specific promoters/enhancers

  • Test effects of ATP1B4 overexpression or knockdown on reporter activity

  • Create mutant versions of binding sites to validate functional importance

These complementary approaches can provide a comprehensive understanding of ATP1B4's role in muscle development and gene regulation.

How Can Researchers Assess ATP1B4's DNA-binding Activity?

Several methods are available for studying ATP1B4's interaction with DNA:

Electrophoretic Mobility Shift Assay (EMSA):

This technique has successfully demonstrated ATP1B4 binding to specific DNA elements:

  • Prepare nuclear extracts with optimal protein concentration (5-8 μg/μL)

  • Design labeled oligonucleotide probes corresponding to potential binding sites

  • Include competition assays with unlabeled oligonucleotides (both wildtype and mutant)

  • Use antibodies against ATP1B4 for supershift assays to confirm specific binding

The specificity of ATP1B4 binding can be validated using mutational analysis. For example, oligonucleotides with mutations that preserve the E-box consensus (M2 and M4) effectively compete for ATP1B4 binding, whereas those with disruptions in the consensus (M1 and M3) do not .

Chromatin Immunoprecipitation (ChIP):

  • Crosslink protein-DNA complexes in muscle cells or tissues

  • Immunoprecipitate ATP1B4-bound chromatin using specific antibodies

  • Analyze enriched DNA by qPCR or sequencing

  • Controls should include IgG antibodies and regions not expected to bind ATP1B4

DNA Pull-down Assays:

  • Immobilize biotinylated DNA fragments containing putative binding sites

  • Incubate with nuclear extracts or purified ATP1B4

  • Identify bound proteins by Western blotting or mass spectrometry

These complementary approaches can provide comprehensive insights into ATP1B4's DNA-binding properties and target genes.

What Are the Recommended Storage Conditions for Recombinant Rat ATP1B4?

Proper storage is crucial for maintaining the stability and activity of Recombinant Rat ATP1B4:

For Lyophilized Protein:

  • Store at -20°C to -80°C

  • Stable for up to 12 months under these conditions

  • Protect from moisture and keep in sealed containers

For Reconstituted Protein:

  • Short-term storage (2-7 days): 4-8°C

  • Long-term storage: Aliquot and store at -20°C or below

  • Avoid repeated freeze-thaw cycles which can lead to protein degradation and activity loss

Buffer Considerations:

  • Tris-based buffers with 50% glycerol have been used successfully for ATP1B4 storage

  • pH should be optimized for protein stability (pH 6.5-7.5 range)

  • Consider adding stabilizing agents such as reducing agents if the protein contains disulfide bonds

Working with the Protein:

  • Thaw aliquots on ice

  • Centrifuge vial before opening to collect all material

  • Reconstitute by gently pipetting buffer down the sides of the vial, avoid vortexing

  • Allow several minutes for complete reconstitution before use

Following these guidelines will help maintain the structural integrity and functional activity of Recombinant Rat ATP1B4 during storage and handling.

What Challenges Exist in Producing Soluble and Functional Recombinant Rat ATP1B4?

Producing soluble and functional Recombinant Rat ATP1B4 presents several challenges that researchers should address:

Protein Solubility Issues:

  • Full-length ATP1B4 contains a transmembrane domain, which can cause insolubility

  • Overexpressed NBD-LRR proteins (including ATP1B4) are often largely insoluble

  • Only a fraction of expressed ATP1B4 is typically found in the soluble fraction after cell lysis

Expression System Selection:

  • E. coli systems may not provide proper folding and post-translational modifications

  • Eukaryotic expression systems (insect or mammalian cells) can improve solubility but have lower yields

  • Baculovirus-infected Hi5 cells have been successfully used for soluble ATP1B4 expression

Purification Challenges:

  • Multi-step purification is necessary to achieve homogeneity

  • Protein may form aggregates during concentration steps

  • Yield can be limited (10-20 μg per liter of insect cell culture has been reported)

Maintaining Functional Activity:

  • Ensuring proper folding and post-translational modifications is essential for activity

  • Buffer optimization is critical for stability throughout purification

  • Activity assays must be established to confirm functionality

Domain-Specific Approaches:

  • Consider expressing specific domains (e.g., the nucleoplasmic domain) rather than the full-length protein

  • Create fusion constructs with solubility-enhancing tags (MBP, SUMO, etc.)

  • Optimize codon usage for the expression system being used

Addressing these challenges requires systematic optimization of expression conditions, careful purification strategy design, and appropriate functional assays to confirm protein activity.

What Experimental Design Approach Is Recommended for Optimizing Recombinant Rat ATP1B4 Expression?

A systematic experimental design approach is highly recommended for optimizing Recombinant Rat ATP1B4 expression instead of traditional trial-and-error methods:

Factorial Design Methodology:

  • Implement a multifactorial design (e.g., 2^4 or 2^8 factorial design) to simultaneously evaluate multiple variables

  • This approach has achieved high yields (250 mg/L) of soluble recombinant protein expression

Key Variables to Optimize:

VariableRange to TestConsiderations
Temperature15-37°CLower temperatures (25°C) often improve solubility
IPTG concentration0.1-1.0 mM0.1 mM has proven effective for many proteins
Induction time4-24 hoursBalance between yield and aggregation
OD600 at induction0.6-1.0Optimal cell density affects expression efficiency
Media compositionVarious formulations5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose has worked well
Host strainBL21(DE3), Rosetta, etc.Consider strains optimized for rare codons
Fusion tagsHis, GST, MBP, SUMOTags can significantly impact solubility

Statistical Analysis and Validation:

  • Use statistical methods to identify significant factors and interactions

  • Validate optimized conditions with triplicate experiments

  • Scale up production using validated conditions

Response Variables to Measure:

  • Total protein yield (mg/L culture)

  • Percentage of soluble vs. insoluble protein

  • Functional activity (specific to ATP1B4's known functions)

This structured approach reduces operational costs and development time compared to traditional trial-and-error methods, while achieving optimal expression conditions for difficult-to-express proteins like ATP1B4.

How Do the Interactome and Function of Rat ATP1B4 Compare to ATP1B4 from Other Species?

The evolutionary diversification of ATP1B4 has resulted in significant differences in interactome and function between species:

Comparative Interactome Analysis:

Species GroupATP1B4 LocationFunctionKey Interactors
Lower vertebrates (fish, amphibians, birds)Plasma membraneNa,K-ATPase β-subunitα-subunits of Na,K-ATPase
Eutherian mammals (including rats)Inner nuclear membraneTranscriptional regulationSKIP, LAP-1, Syne1, HMOX1, HMOX2, LZIP/CREB3, ERGIC3, PHF3, reticulocalbin-3, β-sarcoglycan

Functional Differences:

  • Lower vertebrate ATP1B4:

    • Functions as an ion pump component in the plasma membrane

    • Shows traditional Na,K-ATPase β-subunit activity

    • No interaction with transcriptional regulators detected

  • Eutherian mammal ATP1B4 (including rat):

    • Localizes to the inner nuclear membrane

    • Has lost ancestral ion transport function

    • Acts as a transcriptional co-regulator during muscle development

    • Binds to regulatory regions of muscle-specific genes

    • Promotes epigenetic changes associated with transcriptional activation

    • Highly expressed during late fetal and early postnatal development

Evolutionary Significance:

The transition from ion transport to transcriptional regulation represents a dramatic example of orthologous gene co-option. No new interactions were found for chicken BetaM in screening studies, confirming that the expanded interactome is unique to eutherian BetaM . This evolutionary innovation may provide advantages in muscle development and regulation that contributed to the success of placental mammals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.