Recombinant Rat Protein CLN8 (Cln8)

Shipped with Ice Packs
In Stock

Description

Introduction to CLN8 Protein

The CLN8 protein, encoded by the CLN8 gene, is a transmembrane protein critical for lysosomal function and neuronal health. In rats, recombinant CLN8 (Cln8) refers to the artificially produced form of this protein, enabling detailed study of its structure, interactions, and role in cellular processes . Mutations in CLN8 are linked to neuronal ceroid lipofuscinosis (NCL), a group of neurodegenerative lysosomal storage disorders .

Molecular Structure and Localization

  • Domain Architecture: CLN8 is a multi-pass transmembrane protein with a C-terminal KKRP motif that directs its retention in the endoplasmic reticulum (ER) . Structural predictions indicate 3–5 transmembrane domains, with luminal loops facilitating interactions .

  • Subcellular Localization:

    • Non-neuronal cells: Localizes to the ER and ER-Golgi intermediate compartment (ERGIC) .

    • Neuronal cells: Targets specialized ER subcompartments, dendrites, and axons .

Table 2: Functional Consequences of CLN8 Deficiency

ParameterEffectReference
Lysosomal pHIncreased alkalization (pH ~6.8 vs. ~5.2 in controls)
Dendritic complexityReduced branch length and soma size in hippocampal neurons
Enzyme activity40–60% reduction in cathepsin D and β-hexosaminidase levels

Experimental Models and Recombinant CLN8 Applications

  • Mouse Models:

    • Cln8mnd mice (homozygous frameshift mutation) exhibit motor neuron degeneration, lysosomal enzyme deficits, and early mortality (~10 months) .

    • Recombinant CLN8 expression via AAV9 gene therapy extends lifespan to >24 months and restores lysosomal enzyme activity .

  • In Vitro Studies:

    • Transient transfection of CLN8 in BHK and HEK293 cells confirms ER/ERGIC localization .

    • CLN8 knockdown in rat hippocampal neurons reduces dendritic complexity by 30–50% .

Table 3: Therapeutic Outcomes of CLN8 Restoration in Cln8mnd Mice

ParameterPBS-Treated MiceAAV9-CLN8-Treated MiceReference
Median survival10 months>24 months
Astrocytosis (GFAP)Severe hypertrophyWT-like levels
Motor functionProgressive paralysisNear-normal performance

CLN8-CLN6 Interaction

  • Complex Formation: CLN6 binds CLN8 via its second luminal loop, enabling lysosomal enzyme recruitment .

  • Functional Redundancy: Double-knockout (Cln6–/–Cln8–/–) mice exhibit no additive pathology compared to single mutants, suggesting overlapping roles .

Pathogenic Mutations and Cellular Phenotypes

  • Common Mutations:

    • R24G (Finnish variant): Mild NCL due to partial CLN8 function retention .

    • Truncating mutations: Severe ER retention and lysosomal dysfunction .

  • Cellular Hallmarks:

    • Lysosomal storage of subunit c of mitochondrial ATP synthase .

    • Elevated ER stress and autophagic defects in patient fibroblasts .

Therapeutic Implications

  • Gene Therapy: Intravenous AAV9-CLN8 in mice reduces lysosomal storage, astrocytosis, and behavioral deficits .

  • Pharmacological Targets: Ambroxol and miglustat show potential as enzyme chaperones in CLN8-deficient cells .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
Cln8; Protein CLN8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Cln8
Target Protein Sequence
MTPVSNHGVAESIFDLDYASWKIRSTLAVAGFVFYLGVFVVCHQLSSSLNATYRSLLAKE KVFWNLAATRAVFGIQSTAAGLWALLGDPVLYSNKALGQQNWCWFHITTATGFFFFENAA VHLSNLFFRTFDLFLVVHHLFAFLGFLGSAVNLRAGHYLAMTTLLLEMSTPFTCVSWMLL KAGWSHSLFWKVNQWLMIHMFHCRMILTYHMWWVCFQHWDALASSLYLPHLALFLFGLAL LTVIINPYWTHKKTQQLLNPVDWNFAQPEAKGDRQERTNGQVPRKKRL
Uniprot No.

Target Background

Function
CLN8 may play a role in cell proliferation during neuronal differentiation and in protecting against cell death.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Q&A

What is the cellular localization and basic function of CLN8 protein?

CLN8 is a ubiquitously expressed multi-pass membrane protein that primarily localizes to the endoplasmic reticulum (ER) and the ER-Golgi intermediate compartment (ERGIC). CLN8 functions as a cargo receptor that mediates the ER-to-Golgi transfer of newly synthesized lysosomal enzymes, playing a critical role in lysosome biogenesis .

The protein forms homodimers and contains specific structural elements that enable its trafficking function, including:

  • A KKXX ER retrieval signal in its cytosolic tail

  • A 261VDWNF265 motif that functions as an ER export signal

  • A second luminal loop that mediates interactions with lysosomal enzymes

When investigating CLN8 localization in experimental settings, immunofluorescence microscopy with ER markers (such as calnexin or PDI) is recommended for colocalization studies. Subcellular fractionation techniques followed by immunoblotting can provide complementary quantitative data on protein distribution.

What is the relationship between CLN8 deficiency and lysosomal enzyme trafficking?

CLN8 deficiency causes significant disruptions in lysosomal enzyme trafficking and maturation. Metabolic radiolabeling experiments using CLN8-deficient cells demonstrate that CLN8 deficiency leads to:

  • Delayed maturation of lysosomal enzymes

  • Faster clearance of lysosomal enzymes

  • Inefficient ER exit of newly synthesized lysosomal enzymes

  • Decreased levels of lysosomal enzymes in lysosomes

How does CLN8 interact with lysosomal enzymes for transport?

CLN8 interacts with approximately two-thirds of lysosomal enzymes through its second luminal loop . This interaction can be experimentally demonstrated through:

  • Bimolecular fluorescence complementation (BiFC) assays

  • Co-immunoprecipitation followed by immunoblotting

  • Confocal microscopy tracking of protein complexes

Deletion of the second luminal loop (CLN8ΔL) disrupts the interaction with lysosomal enzymes while maintaining proper protein localization and trafficking ability . Pathogenic mutations mapped to this loop significantly reduce interactions with lysosomal cargoes, highlighting its functional importance.

The methodological approach recommended for studying these interactions involves:

  • Creating tagged versions of both CLN8 and target lysosomal enzymes

  • Performing pairwise transfections in suitable cell lines

  • Quantifying interactions through flow cytometry or microscopy

  • Validating findings through co-immunoprecipitation experiments

How does the CLN6-CLN8 complex (EGRESS) coordinate lysosomal enzyme transport?

Recent research has identified that CLN6 and CLN8 form an obligate complex named EGRESS (ER-to-Golgi relaying of enzymes of the lysosomal system) that coordinates lysosomal enzyme transport . This complex functions as a functional unit with distinct roles for each component:

  • CLN6 remains in the ER and is required for recruiting lysosomal enzymes

  • CLN8 interacts with both CLN6 and the lysosomal enzymes

  • CLN8 is loaded into COPII vesicles and transports the enzymes to the Golgi

  • CLN8 then recycles back to the ER via COPI vesicles

Experimental evidence suggests CLN6 and CLN8 deficiencies do not have additive effects in mouse models, supporting the concept that they function within the same pathway . The second luminal loop of CLN6 is specifically required for interaction with lysosomal enzymes but is dispensable for interaction with CLN8 .

When investigating this complex, researchers should consider:

  • Simultaneous knockdown/knockout of both proteins to assess functional redundancy

  • Mutagenesis of specific domains to differentiate interaction interfaces

  • Trafficking assays to track the movement of complexes through secretory compartments

What are the molecular mechanisms underlying CLN8's bidirectional trafficking between ER and Golgi?

CLN8 trafficking depends on specific motifs that mediate its interactions with COPII (anterograde transport) and COPI (retrograde transport) vesicle components:

  • COPII-mediated ER export: CLN8 interacts with Sec24A and Sec24C subunits via its 261VDWNF265 motif. Mutation of this motif severely diminishes Golgi localization, confirming its role as an ER export signal .

  • COPI-mediated ER retrieval: CLN8 contains a KKXX signal that mediates interaction with the COPI complex, allowing recycling from the Golgi back to the ER .

To investigate these trafficking mechanisms, the following methodological approaches are recommended:

  • BiFC assays combined with confocal microscopy to track protein complex localization

  • Mutagenesis of trafficking motifs (KKXX and 261VDWNF265)

  • COPI inhibition using brefeldin A (CBM)

  • GST pulldown assays with the cytosolic tail of CLN8 to identify interacting partners

It's worth noting that the pathogenic mutation W263C disrupts the ER export motif, directly linking trafficking defects to disease pathology .

How can contradictory data regarding CLN8 function be reconciled in experimental design?

When designing experiments to study CLN8, researchers must account for several potential variables that could lead to contradictory results:

To resolve contradictory data, researchers should:

  • Use multiple cell lines and primary cultures from different tissues

  • Apply both acute (siRNA) and chronic (CRISPR) depletion strategies

  • Perform rescue experiments with wild-type and mutant proteins

  • Employ quantitative methods to measure enzyme trafficking kinetics

What are optimal methods for studying CLN8-enzyme interactions in vitro?

Several complementary approaches can be used to study CLN8-enzyme interactions with varying degrees of resolution and throughput:

MethodAdvantagesLimitationsAppropriate Controls
Bimolecular Fluorescence Complementation (BiFC)Allows visualization of interactions in live cells; quantifiable by flow cytometryIrreversible complex formation; potential artifactual interactionsEmpty vectors; non-interacting protein pairs
Co-immunoprecipitationDetects native complexes; can be scaled for proteomicsMay not capture transient interactions; requires good antibodiesIgG controls; reverse IP; input controls
Proximity Ligation AssayHigh sensitivity; detects endogenous proteinsComplex protocol; potential false positivesOmission of primary antibodies; non-interacting proteins
GST pulldownDefines specific domains involved in interactionsIn vitro conditions may not reflect cellular environmentGST-only controls; mutated domain controls

For studying CLN8-enzyme interactions, the following methodological workflow is recommended:

  • Generate expression constructs for CLN8 and target lysosomal enzymes with appropriate tags

  • Perform initial screening by BiFC/flow cytometry to identify interacting partners

  • Validate key interactions by co-immunoprecipitation

  • Map interaction domains through deletion/mutation constructs

  • Confirm physiological relevance through trafficking assays

CLN8's second luminal loop is critical for enzyme interactions, so creating loop deletion mutants or point mutations in this region is particularly informative .

What cellular models are most appropriate for investigating CLN8 function?

Different cellular models offer distinct advantages for investigating specific aspects of CLN8 function:

Cell TypeAdvantagesRecommended Applications
HEK293 cellsHigh transfection efficiency; easily manipulatedProtein-protein interaction studies; trafficking assays
Neuronal cell linesMore relevant to disease pathologyNeuron-specific effects; degeneration mechanisms
Patient-derived fibroblastsContain disease-causing mutationsCorrelation of biochemical defects with mutations
Primary neurons from Cln8 mouse modelsPhysiological expression levels; disease phenotypeIn vivo relevance; therapeutic testing
CRISPR-edited cell linesComplete protein ablation; isogenic controlsFundamental mechanism studies; rescue experiments

When selecting cellular models, consider:

  • The specific research question (mechanism, pathology, or therapeutic approach)

  • Required protein expression levels (endogenous vs. overexpression)

  • Need for specialized cellular machinery (neuron-specific processes)

  • Timeframe of experiments (acute vs. chronic effects)

For studying trafficking dynamics, HeLa or HEK293 cells with CRISPR/Cas9 knockout of CLN8 provide a clean background for rescue experiments with wild-type or mutant constructs . For disease mechanisms, primary neurons from Cln8 mouse models more accurately reflect the pathological environment.

How can researchers effectively measure lysosomal enzyme trafficking defects in CLN8-deficient models?

Multiple complementary approaches can be employed to quantify trafficking defects:

  • Metabolic radiolabeling: Pulse-chase experiments with [35S]methionine/cysteine can track the maturation kinetics of lysosomal enzymes. In CLN8-deficient cells, expect delayed maturation patterns and faster clearance of immature forms .

  • Subcellular fractionation: Nycodenz gradient centrifugation to isolate lysosome-enriched fractions followed by immunoblotting or mass spectrometry. Quantitative comparison between wild-type and CLN8-deficient samples reveals depletion of lysosomal enzymes .

  • Live-cell imaging: Fluorescently tagged lysosomal enzymes can be tracked in real-time to visualize trafficking defects.

  • Enzyme activity assays: Measure activities of multiple lysosomal enzymes in subcellular fractions to assess functional impact of trafficking defects.

  • Glycosylation analysis: Monitor acquisition of complex carbohydrates as enzymes traffic through the Golgi using endoglycosidase H sensitivity.

A comprehensive trafficking analysis should include:

  • Multiple timepoints to capture kinetic differences

  • Multiple enzymes to identify cargo specificity

  • Transcript analysis to distinguish trafficking from expression defects

  • Rescue experiments to confirm specificity of observed defects

How do pathogenic mutations in CLN8 impact protein function at the molecular level?

Pathogenic mutations in CLN8 can disrupt protein function through several mechanisms:

When investigating pathogenic mutations, researchers should:

  • Assess protein stability and half-life through cycloheximide chase experiments

  • Evaluate subcellular localization using confocal microscopy

  • Measure interaction with partner proteins (CLN6, lysosomal enzymes, COPI/COPII components)

  • Perform rescue experiments in CLN8-deficient cells

  • Compare multiple mutations to identify common mechanisms

What research methodologies can elucidate the relationship between CLN8 dysfunction and neurodegeneration in Batten disease?

Investigating the connection between CLN8 dysfunction and neurodegeneration requires integrated approaches:

  • Neuron-specific consequences: Primary neuronal cultures from CLN8-deficient mice can be used to evaluate:

    • Lysosomal enzyme trafficking and activity

    • Accumulation of storage materials

    • Neurite outgrowth and synaptic function

    • Vulnerability to stress conditions

  • Circuit-level analysis: Brain sections from CLN8-deficient animals can reveal:

    • Regional vulnerability patterns

    • Temporal progression of pathology

    • Correlation between enzyme deficiency and neuronal loss

  • Patient-derived models: iPSC-derived neurons from CLN8 patients provide human-specific insights into:

    • Species-specific differences in CLN8 function

    • Cell type-specific vulnerability

    • Potential therapeutic targets

Methodological approach should include:

  • Comparison of neuronal and non-neuronal cells from the same model

  • Temporal analysis from pre-symptomatic to late-stage disease

  • Correlation of biochemical defects with morphological and functional changes

  • Assessment of specific lysosomal enzymes known to be affected by CLN8 deficiency

What experimental approaches can assess potential therapeutic strategies for CLN8-related disorders?

Based on CLN8's function as a lysosomal enzyme transporter, several therapeutic strategies can be experimentally evaluated:

  • Enzyme replacement therapy (ERT):

    • Test if exogenous delivery of lysosomal enzymes bypasses the trafficking defect

    • Compare uptake and distribution in wild-type versus CLN8-deficient cells

    • Evaluate dosing requirements for neuronal versus non-neuronal tissues

  • Gene therapy approaches:

    • Assess viral vector-mediated delivery of CLN8 using AAV or lentiviral systems

    • Evaluate rescue of enzyme trafficking and activity

    • Determine minimum expression levels needed for therapeutic effect

  • Small molecule therapeutics:

    • Screen for compounds that enhance residual CLN8 function or stabilize mutant protein

    • Test ERAD inhibitors that may increase amounts of functional mutant CLN8

    • Evaluate compounds that promote alternative trafficking pathways for lysosomal enzymes

  • Therapeutic combination strategies:

    • Test if simultaneous targeting of multiple pathways provides synergistic benefits

    • Evaluate ERT combined with gene therapy or small molecules

    • Assess targeting of downstream pathological processes alongside addressing primary defect

Experimental design should include:

  • Dose-response and time-course analyses

  • Multiple readouts (enzyme levels, trafficking, function, storage material)

  • Assessment in relevant cellular and animal models

  • Comparison with established treatments for other lysosomal storage disorders

What are the optimal expression systems for producing functional recombinant rat CLN8 protein?

Producing functional recombinant rat CLN8 presents specific challenges due to its multi-pass membrane structure. Optimal expression systems include:

Expression SystemAdvantagesLimitationsRecommended Applications
Mammalian cell lines (HEK293, CHO)Native post-translational modifications; proper foldingLower yield; higher costFunctional studies; structural analysis
Insect cells (Sf9, Hi5)Higher yield than mammalian; eukaryotic processingSome glycosylation differencesProtein-protein interaction studies
Cell-free systemsRapid production; direct incorporation into liposomesLimited post-translational modificationsPreliminary binding studies
E. coli with solubility tagsHigh yield; cost-effectiveLacks glycosylation; refolding challengesAntibody production; domain mapping

For producing functional rat CLN8:

  • Use full-length cDNA with codon optimization for the selected expression system

  • Include purification tags that don't interfere with the second luminal loop

  • Consider adding stabilizing mutations for improved yield

  • Validate proper folding through functional interaction assays

The method of extraction and purification is critical - detergent selection must balance efficient extraction with maintenance of protein-protein interactions.

What are the most reliable antibodies and detection methods for rat CLN8 in different experimental contexts?

Selection of appropriate antibodies and detection methods is crucial for reliable CLN8 research:

  • Western blotting:

    • Recommended sample preparation: Membrane fractionation rather than whole cell lysates

    • Loading controls: Calnexin (ER membrane) is more appropriate than cytosolic proteins

    • Sample denaturation: Avoid boiling to prevent aggregation of multi-pass membrane proteins

  • Immunofluorescence:

    • Fixation method: 4% paraformaldehyde with controlled permeabilization

    • Colocalization markers: PDI or calnexin (ER), ERGIC-53 (ERGIC), GM130 (Golgi)

    • Signal amplification: Consider tyramide signal amplification for detecting endogenous levels

  • Flow cytometry:

    • Surface epitopes: Target extracellular loops in non-permeabilized cells

    • Intracellular epitopes: Optimize permeabilization to maintain epitope accessibility

When working with rat CLN8 specifically, validate antibody specificity using:

  • CLN8 knockout tissues/cells as negative controls

  • Overexpression systems as positive controls

  • Peptide competition assays to confirm specificity

  • Cross-reactivity testing if using antibodies raised against human CLN8

What are the key considerations for designing CRISPR/Cas9 knockout and knockin strategies for rat CLN8?

Effective genetic modification of CLN8 requires careful design considerations:

  • CRISPR knockout strategies:

    • Target early exons to ensure complete loss of function

    • Design multiple guide RNAs to increase efficiency

    • Consider potential off-target effects in related genes

    • Validate knockout through sequencing, protein detection, and functional assays

    • Be aware that compensatory mechanisms may develop in complete knockouts

  • Knockin mutation strategies:

    • For studying specific mutations, design repair templates with patient-specific variants

    • Include silent mutations to prevent re-cutting by Cas9

    • Consider adding epitope tags for detection, but avoid the second luminal loop

    • Validate knockins through sequencing and functional testing of protein interactions

  • Conditional approaches:

    • For developmental studies, consider floxed alleles with tissue-specific Cre expression

    • Inducible systems allow temporal control to distinguish acute from chronic effects

    • Partial knockdown using CRISPRi may avoid compensatory mechanisms

  • Screening and validation:

    • Design PCR strategies that can detect both homozygous and heterozygous modifications

    • Confirm altered protein function through interaction and trafficking assays

    • Verify phenotypic relevance through lysosomal enzyme measurements and localization studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.