Recombinant Rat Protein CNPPD1 (Cnppd1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Cnppd1; Protein CNPPD1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Cnppd1
Target Protein Sequence
MDLAGLLLDEEGTFSLSGFQDFTFLPGHQKLSARIRRRLYYGWDLETDCSLEELSSPVAD ITVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVPTLNALERSFLSAMDWRLYTDPRE IFEVLSWLESCVAEQQGRRRGWYTYTDLCVLLEQPMWQLSLGSLCQRLVKLSCLLAVAYV SSVALAVASMAVIHQSLGLSSSPSPSPPELTLVPKNLLQPCIPAPVPQCLTNVSSCLEDS VELPSLWGSLLDPLTPPLMPPPDPPAPPTPFHKCPFCQKFQRNPPNCRACHQPNRTVSIG PIHPFYHTHGLAPPWLWSPVAPPFLQPQQCSLFSVMKLARLTSVIFPG
Uniprot No.

Target Background

Database Links
Protein Families
CNPPD1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is CNPPD1 and what are its known biological functions in rat models?

CNPPD1 (Cyclin Fold Protein-Containing Protein 1) is a protein involved in cell cycle regulation and cellular signaling pathways. While specific research on rat CNPPD1 is still developing, the protein contains a cyclin-fold domain that suggests roles in cell proliferation and differentiation similar to other cyclin-fold containing proteins. Current methodological approaches to studying its function include:

  • Knockout/knockdown studies in rat cell lines

  • Co-immunoprecipitation experiments to identify binding partners

  • Immunohistochemistry to determine tissue distribution and subcellular localization

  • Expression profiling during various developmental stages

Research using recombinant rat CNPPD1 allows for controlled investigation of its specific functions in isolation from other cellular components.

How does recombinant rat CNPPD1 differ from its human ortholog?

The rat CNPPD1 shares approximately 85-90% amino acid sequence homology with its human ortholog, with key differences primarily in non-conserved regions. When designing experiments, researchers should consider:

  • Conserved functional domains between species (particularly the cyclin-fold domain)

  • Species-specific post-translational modifications

  • Differential binding affinities to interacting proteins

  • Potential variations in subcellular localization

These differences necessitate species-specific validation when extrapolating findings between human and rat models.

What expression systems are most suitable for producing recombinant rat CNPPD1?

Based on protocols established for other recombinant rat proteins, several expression systems have shown promise:

  • E. coli-based systems are often used for initial production, similar to methods used for rat CNTF protein (Ala2-Met200)

  • Mammalian expression systems may provide more appropriate post-translational modifications

  • Baculovirus-insect cell systems offer a compromise between bacterial yield and eukaryotic processing

The choice depends on experimental needs - bacterial systems provide higher yields but lack certain post-translational modifications, while mammalian systems better preserve native protein conformation.

What purification strategies yield highest purity and activity for recombinant rat CNPPD1?

Optimal purification strategies typically involve multiple chromatography steps:

  • Initial capture using affinity chromatography (His-tag or GST-tag approaches)

  • Intermediate purification with ion exchange chromatography

  • Polishing step using size exclusion chromatography

Purification MethodTypical YieldPurityAdvantagesLimitations
Ni-NTA (His-tagged)3-5 mg/L culture>90%Single-step enrichmentMay affect protein activity
GST-fusion approach2-4 mg/L culture>85%Enhanced solubilityLarger tag size
Ion exchangeVaries by protein>95%Removes charged contaminantsBuffer optimization required
Size exclusion70-90% recovery>98%Removes aggregatesDilutes sample

Analytical methods including SDS-PAGE, Western blotting, and mass spectrometry should be employed to confirm purity and identity.

How should bioactivity of recombinant rat CNPPD1 be measured and validated?

Bioactivity validation should include multiple complementary approaches:

  • Functional assays: Cell-based proliferation or differentiation assays, similar to those used for CNTF (where ED50 values of 0.1-0.3 ng/mL are observed for neurite outgrowth)

  • Binding assays: Surface plasmon resonance (SPR) or microscale thermophoresis to measure interaction with known binding partners

  • Structural integrity: Circular dichroism spectroscopy to confirm secondary structure

  • Thermal stability: Differential scanning fluorimetry to assess protein stability

Activity comparisons should be made against a reference standard when possible, with EC50/IC50 values clearly reported.

What are the optimal storage conditions for maintaining recombinant rat CNPPD1 stability?

Based on stability protocols for similar recombinant rat proteins:

Storage FormatTemperatureBuffer ConditionsExpected StabilityNotes
Lyophilized-20°C to -80°CWith carrier proteins>12 monthsPreferred for long-term storage
Solution-80°CPBS with 10-25% glycerol6-12 monthsAvoid repeated freeze-thaw cycles
Working solution4°CPBS with 0.1% BSA1-2 weeksFor immediate use

Stability should be validated through activity assays at regular intervals. The addition of carrier proteins (e.g., BSA) at 0.1-0.5% can enhance stability during storage and handling, similar to the carrier options available for other recombinant rat proteins .

How can recombinant rat CNPPD1 be used to investigate protein-protein interactions in neuronal systems?

Advanced techniques for studying CNPPD1 interactions include:

  • Proximity labeling approaches: BioID or APEX2 fusion proteins to identify proximal interacting partners in living cells

  • FRET/BRET assays: To study real-time interactions and conformational changes

  • Crosslinking mass spectrometry: To map interaction interfaces at amino acid resolution

  • Co-immunoprecipitation followed by TMT-based quantitative proteomics: Similar to techniques used in rat brain proteome studies

When designing interaction studies, researchers should consider both direct binding partners and components of larger protein complexes, as proteogenomic approaches have successfully identified variant peptides and protein networks in rat brain studies .

What are the challenges in developing antibodies against rat CNPPD1 for immunological applications?

Developing specific antibodies presents several technical challenges:

  • Identifying unique epitopes that distinguish CNPPD1 from related proteins

  • Accounting for potential post-translational modifications that may mask epitopes

  • Cross-reactivity testing against related rat proteins and orthologs from other species

Validation strategies should include:

  • Western blotting with recombinant protein as positive control

  • Immunoprecipitation followed by mass spectrometry

  • Immunohistochemistry with appropriate knockout controls

  • Peptide competition assays to confirm specificity

How can CRISPR-Cas9 gene editing be optimized for studying CNPPD1 function in rat cell lines?

Effective CRISPR-Cas9 strategies include:

ApproachAdvantagesConsiderationsValidation Methods
Complete knockoutEliminates all protein functionMay be lethal if essentialWestern blot, genomic sequencing
Domain-specific editingTargets specific functionsRequires detailed structural knowledgeFunctional assays specific to domain
Knockin tagsEnables visualization and pulldownMay interfere with functionLocalization studies, interaction screening
Inducible systemsTemporal control of editingLeakiness of induction systemTime-course analysis of protein levels

Guide RNA design should consider rat-specific genomic sequences, potential off-target sites, and efficiency of editing. Validation through proteomics approaches similar to those used in rat brain studies can confirm the specific effects on protein expression .

How should researchers address batch-to-batch variation in recombinant rat CNPPD1 activity?

To minimize and manage batch variation:

  • Implement standardized production protocols with defined quality control metrics

  • Establish a reference standard against which each batch is calibrated

  • Perform multiple bioactivity assays to create a comprehensive activity profile

  • Document batch information in publications (production date, lot number, activity measurements)

Statistical analysis should include batch effects as a variable, similar to the batch effect removal using the limma R package described in proteomic studies .

What are common pitfalls in designing experiments to study CNPPD1's role in cell signaling pathways?

Common experimental design pitfalls include:

  • Insufficient controls for protein specificity (use closely related proteins as controls)

  • Overlooking potential confounding factors from expression tags

  • Inadequate dose-response testing (typically requires a range spanning 0.1-100 ng/mL based on similar proteins)

  • Failure to account for endogenous CNPPD1 expression in the experimental system

Researchers should design experiments with appropriate positive and negative controls, dose-response curves, and time-course analyses to establish causality in signaling events.

How can contradictory results between in vitro and in vivo studies of CNPPD1 function be reconciled?

When facing contradictory results:

  • Systematically compare experimental conditions:

    • Protein concentration differences between systems

    • Presence of binding partners in complex environments

    • Post-translational modifications present in vivo but absent in vitro

  • Consider microenvironmental factors:

    • pH and ionic strength differences

    • Presence of extracellular matrix components

    • Cell type-specific effects

  • Employ intermediate complexity models:

    • Organoid cultures

    • Ex vivo tissue preparations

    • Primary cell cultures vs. cell lines

How might proteogenomic approaches enhance our understanding of CNPPD1 function and regulation?

Proteogenomic integration, similar to approaches used in rat brain studies , offers several advantages:

  • Identification of protein variants resulting from alternative splicing or genetic variants

  • Correlation of protein expression with genetic loci through pQTL analysis

  • Discovery of post-translational modifications affecting protein function

  • Integration of protein expression data with phenotypic traits

These approaches require sophisticated bioinformatic pipelines but can reveal regulatory networks and genetic influences on CNPPD1 expression and function that traditional methods might miss.

What is known about sex-specific differences in CNPPD1 expression and function in rat models?

Current understanding of sex-specific differences remains limited, but methodology for investigation should include:

  • Comparison of expression levels between male and female tissues using quantitative proteomics

  • Analysis of potential sex-specific pQTLs, similar to approaches used in rat brain proteome studies

  • Hormone response element analysis in the CNPPD1

  • Sex-stratified functional assays in primary cells from male and female rats

Preliminary data from other proteins suggests that while many proteins show minimal sex differences, a subset may display significant divergence in expression or function between sexes .

How can researchers use CNPPD1 protein expression data to identify links to complex neurodevelopmental or neurodegenerative disorders?

Integrative approaches should include:

  • Correlation of CNPPD1 expression levels with behavioral or physiological phenotypes

  • Analysis of genetic variants affecting CNPPD1 expression (pQTLs) and their overlap with disease-associated loci

  • Network analysis to identify functional pathways connecting CNPPD1 to disease-related proteins

  • Cross-species validation of findings between rat models and human data

This approach has successfully linked rat pQTLs to human disorders for other proteins, suggesting potential translational relevance for CNPPD1 research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.