Recombinant Rat Protein cornichon homolog 2 (Cnih2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
Cnih2; Protein cornichon homolog 2; CNIH-2; Cornichon family AMPA receptor auxiliary protein 2; Cornichon-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Cnih2
Target Protein Sequence
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERI CCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAV SIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF
Uniprot No.

Target Background

Function

Recombinant Rat Cornichon Homolog 2 (CNIH2) regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). It facilitates their membrane and synaptic targeting, modulating gating properties by influencing activation, deactivation, and desensitization rates. Furthermore, it inhibits CACNG8-mediated AMPA receptor resensitization.

Gene References Into Functions
  1. Mammalian AMPARs utilize CNIH-2 as a functional auxiliary subunit, modifying receptor signaling. PMID: 22292017
  2. CNIH-2 modulates AMPAR auxiliary subunit assembly by regulating the number of transmembrane AMPAR regulatory proteins within the complex, thereby affecting receptor gating and pharmacology. PMID: 21543622
  3. Studies demonstrate that most brain AMPARs co-assemble with CNIH-2 and CNIH-3. Cornichons enhance AMPAR surface expression and alter channel gating by significantly slowing deactivation and desensitization kinetics. PMID: 19265014
Database Links
Protein Families
Cornichon family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, dendritic spine. Cell junction, synapse, postsynaptic density. Note=Also localizes to the cell membrane of extrasynaptic sites (dendritic shafts, spines of pyramidal cells).
Tissue Specificity
Brain. Expressed in the neocortex, hippocampal formation, and cerebellum (at protein level).

Q&A

What is Protein Cornichon Homolog 2 (Cnih2) and what is its function in neural systems?

Protein Cornichon Homolog 2 (Cnih2) is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. In the central nervous system, AMPA receptors mediate fast synaptic neurotransmission, and Cnih2 plays a crucial role in modulating receptor function. Specifically, Cnih2 interacts with Type I AMPA receptor regulatory proteins (particularly isoform gamma-8) to control the assembly of hippocampal AMPA receptor complexes . This interaction directly influences receptor gating properties and pharmacological responses, making Cnih2 an important regulatory component in glutamatergic neurotransmission.

The protein has a transmembrane topology and belongs to a family of four cornichon homologs (CNIH-1 to CNIH-4), though research has demonstrated that only CNIH-2 and CNIH-3 interact with AMPARs in the rat brain . This selective interaction suggests specialized evolutionary roles for different cornichon homologs.

How does Cnih2 differ from other members of the cornichon homolog family?

The cornichon family consists of four homologs (CNIH-1 to CNIH-4), but they demonstrate important functional differences. While all family members share a basic topology, CNIH-2 and CNIH-3 contain additional unique sequences within their extracellular loops that are absent in CNIH-1 and CNIH-4 .

This structural distinction is significant because only CNIH-2 and CNIH-3 have been experimentally confirmed to interact with AMPA receptors in rat brain tissue. Research conducted using co-immunoprecipitation and biochemical purification techniques has demonstrated that CNIH-3 forms stable complexes with tetrameric AMPA receptors, particularly with the GluA2 subunit . Similar binding properties are observed with CNIH-2, suggesting these two homologs evolved specialized roles in modulating glutamatergic signaling, while CNIH-1 and CNIH-4 likely serve different cellular functions.

What are the most effective protocols for purifying Cnih2-AMPAR complexes?

Purification of Cnih2-AMPAR complexes requires a carefully optimized protocol to maintain the integrity of the protein interactions. Based on established methodologies for similar complexes, the following approach is recommended:

  • Co-expression in a stable cell line: Establish a doxycycline (DOX) inducible system for co-expressing GluA2 (an AMPAR subunit) and Cnih2 in HEK293 cells, similar to methods used for CNIH-3 .

  • Immunoaffinity chromatography: After cell lysis in appropriate detergent buffer (typically containing 1% Triton X-100), perform immunoaffinity purification using antibodies against either GluA2 or an epitope-tagged Cnih2. Cross-linking antibodies to protein A Sepharose beads using DMP (dimethyl pimelimidate) significantly improves purification efficiency .

  • Elution strategy: For FLAG-tagged constructs, elution can be performed using FLAG peptide (0.5 mg/ml) in appropriate buffer conditions .

  • Gel filtration chromatography: Further purify the immunoaffinity-isolated complexes using size exclusion chromatography to separate tetrameric AMPAR-Cnih2 complexes from unbound components. The Cnih2-AMPAR complexes typically elute in fractions corresponding to tetrameric AMPARs .

It is important to note that a portion of Cnih2 may dissociate from the AMPAR complex during chromatography, necessitating careful fraction analysis via Western blotting to identify stable complexes.

What expression systems are optimal for producing recombinant rat Cnih2 for structural studies?

For structural studies requiring high-quality recombinant rat Cnih2, several expression systems can be considered, each with distinct advantages:

  • Mammalian expression systems: HEK293 cells are preferred for producing properly folded Cnih2 with native-like post-translational modifications. These cells can be transiently transfected or engineered into stable lines using doxycycline-inducible systems as demonstrated for related cornichon proteins . This system is particularly advantageous for co-expression studies with AMPAR subunits.

  • Insect cell expression: Baculovirus-infected Sf9 or Hi5 cells can produce larger quantities of protein with mammalian-like post-translational processing, which is beneficial for structural studies requiring milligram quantities of protein.

  • Bacterial expression: For studies focusing on specific domains rather than the full transmembrane protein, E. coli expression of fusion proteins (such as MBP or SUMO fusions) can be optimized to produce soluble fragments, particularly of the N-terminal or C-terminal domains.

When designing expression constructs, researchers should consider:

  • Including affinity tags (His6, FLAG) for purification

  • Incorporating fluorescent protein fusions for localization studies

  • Optimizing codon usage for the host expression system

  • Including protease cleavage sites to remove tags after purification

Storage recommendations include maintaining purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage, with minimal freeze-thaw cycles to preserve activity .

How can peptide array experiments be designed to map the interaction interface between Cnih2 and AMPA receptors?

Peptide array experiments represent a powerful approach to map protein-protein interaction interfaces between Cnih2 and AMPA receptors. Based on established methodologies for related cornichon proteins, researchers should consider the following design principles:

  • Peptide library design:

    • Create a comprehensive library of overlapping peptides spanning the entire Cnih2 sequence

    • Each spot should correspond to approximately 15-20 amino acids of the protein

    • Use a sequential offset of 2-3 amino acids between adjacent spots to ensure thorough coverage of all potential binding epitopes

    • For initial screening, include the complete Cnih2 sequence

    • For follow-up studies, focus on regions of interest (e.g., the transmembrane domains and extracellular loop)

  • Array preparation:

    • Synthesize peptides directly on membranes using SPOT synthesis technology

    • Wash membranes sequentially with methanol, water, and protein purification buffer

    • Block with purification buffer containing 5% BSA to prevent non-specific binding

  • Binding protocol:

    • Incubate arrays with purified AMPA receptor components (full-length GluA2, S1S2 domain, or N-terminal domain)

    • Maintain consistent protein concentration and incubation conditions (typically 4°C for 4 hours)

    • Include appropriate controls, such as unrelated proteins of similar size

  • Detection methods:

    • Use antibodies against the AMPA receptor (anti-GluA2 C-terminus) or against tags present in the recombinant AMPAR constructs

    • Employ HRP-conjugated secondary antibodies and chemiluminescent detection for high sensitivity

    • Consider quantitative analysis of spot intensity for comparative binding studies

This approach can successfully identify specific sequences within Cnih2 that mediate its interaction with AMPA receptors, providing valuable structural insights for further functional studies.

How can Cnih2 knockdown or overexpression be used to study AMPAR trafficking and assembly?

Manipulating Cnih2 expression levels provides powerful tools for investigating its role in AMPAR trafficking and assembly. Both knockdown and overexpression approaches offer complementary insights:

Knockdown strategies:

  • shRNA/siRNA approaches: Design target-specific RNA interference constructs against rat Cnih2 mRNA. For neuronal studies, lentiviral delivery offers stable expression in primary cultures or in vivo.

  • CRISPR-Cas9 genome editing: For complete knockout studies, design guide RNAs targeting exonic regions of Cnih2. This approach can be applied in cell lines or for generating knockout animal models.

  • Anticipated outcomes: Cnih2 knockdown typically reduces surface expression of GluA2-containing AMPARs and alters receptor kinetics. Researchers should monitor:

    • Total and surface AMPAR levels via biotinylation assays

    • AMPAR subunit composition using co-immunoprecipitation

    • Receptor trafficking using live-cell imaging with pH-sensitive GFP-tagged receptors

    • Electrophysiological properties including desensitization kinetics and rectification

Overexpression approaches:

  • Construct design: Express rat Cnih2 using lentiviral vectors with neuron-specific promoters. Including epitope tags (FLAG, HA) facilitates detection without interfering with function.

  • Rescue experiments: Co-express Cnih2 with knockdown constructs targeting endogenous Cnih2 to verify specificity.

  • Expected effects: Cnih2 overexpression typically enhances AMPAR surface expression and modifies channel properties. Key measurements should include:

    • Altered AMPAR gating properties

    • Changes in receptor trafficking rates

    • Modifications to synaptic strength and plasticity

These complementary approaches can reveal how Cnih2 regulates AMPAR function at multiple levels, from trafficking to electrophysiological properties, advancing our understanding of glutamatergic signaling mechanisms.

What are the key considerations for designing electrophysiological experiments to study Cnih2's effects on AMPAR function?

Electrophysiological investigations of Cnih2's effects on AMPAR function require careful experimental design to capture the nuanced modulation of receptor properties. Researchers should consider:

By systematically examining these parameters, researchers can develop a comprehensive understanding of how Cnih2 modulates AMPAR function in both physiological and pathological contexts.

How can structural biology approaches be used to elucidate the Cnih2-AMPAR interaction interface?

Structural biology offers powerful approaches to reveal the molecular details of Cnih2-AMPAR interactions. Researchers investigating this complex should consider multiple complementary methods:

  • Cryo-electron microscopy (cryo-EM):

    • Most suitable for visualizing the entire AMPAR-Cnih2 complex

    • Sample preparation should focus on stabilizing the complex during purification

    • Consider using antibody fragments (Fabs) to increase particle size and facilitate alignment

    • Target resolution of <4Å to resolve secondary structure elements at the interface

  • X-ray crystallography:

    • Challenging for full transmembrane complexes but powerful for domain interactions

    • Focus on crystallizing the extracellular domains of AMPARs in complex with the extracellular loop of Cnih2

    • Use lipidic cubic phase crystallization for membrane protein components

    • Consider fusion proteins to enhance crystallizability

  • Cross-linking mass spectrometry (XL-MS):

    • Employ chemical cross-linkers of defined length to capture interaction points

    • Use MS2/MS3 fragmentation to identify cross-linked peptides

    • Generate distance restraints to model the complex when high-resolution structures are unavailable

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Identify regions with altered solvent accessibility upon complex formation

    • Particularly useful for mapping conformational changes induced by Cnih2 binding

  • Complementary biochemical approaches:

    • Peptide array experiments as detailed previously

    • Mutagenesis of identified interface residues to validate structural models

    • Chimeric proteins swapping domains between CNIH family members to identify specificity determinants

By integrating data from these approaches, researchers can develop high-confidence structural models of the Cnih2-AMPAR complex, providing mechanistic insights into how this auxiliary protein modulates receptor function.

How does Cnih2 distribution vary across brain regions and cell types, and what are the methodological approaches to study this?

Understanding the spatial distribution of Cnih2 across brain regions and cell types provides crucial insights into its specialized functions. Multiple complementary techniques can be employed to map Cnih2 expression patterns:

  • Transcriptomic approaches:

    • Single-cell RNA sequencing: Provides cell-type specific expression data with high resolution

    • In situ hybridization: RNAscope technology offers sensitive detection of Cnih2 mRNA while preserving spatial information

    • Quantitative PCR: For comparing relative expression levels across gross brain regions

  • Protein-level detection:

    • Immunohistochemistry/immunofluorescence: Requires validated antibodies against rat Cnih2

    • Western blotting: For quantitative comparison across brain regions

    • Mass spectrometry-based proteomics: Provides unbiased protein identification and quantification

  • Cellular localization studies:

    • Subcellular fractionation: To determine enrichment in different cellular compartments

    • Electron microscopy with immunogold labeling: For precise subcellular localization

    • Super-resolution microscopy: To visualize co-localization with AMPAR subunits at synapses

  • Developmental considerations:

    • Compare expression patterns across different developmental stages

    • Correlate with critical periods of synaptic plasticity

Published data from related studies suggest that Cnih2, like CNIH-3, is likely enriched in the hippocampus and cerebral cortex, with expression patterns that may complement TARP auxiliary subunits . Cell-type specific patterns may reveal preferential expression in excitatory versus inhibitory neurons, providing clues to its specialized functions in neural circuits.

What are the methodological approaches to study the role of Cnih2 in synaptic plasticity?

Investigating Cnih2's role in synaptic plasticity requires a multi-level experimental approach that spans molecular interactions to behavioral outcomes:

  • Electrophysiological approaches:

    • Long-term potentiation (LTP) protocols: Compare wild-type and Cnih2-manipulated neurons using high-frequency stimulation or theta-burst stimulation

    • Long-term depression (LTD): Evaluate low-frequency stimulation or chemically-induced LTD

    • Paired-pulse facilitation: To assess presynaptic versus postsynaptic effects

    • AMPAR/NMDAR ratio measurements: As indicators of synaptic strength and maturation

  • Molecular mechanisms:

    • Surface biotinylation assays: To track activity-dependent AMPAR trafficking

    • Live imaging approaches: Using pH-sensitive GFP-tagged AMPARs to visualize receptor insertion/removal

    • Phosphorylation studies: Examining how activity-dependent signaling affects Cnih2-AMPAR interactions

  • Structural plasticity correlates:

    • Dendritic spine morphology analysis: Using confocal or two-photon microscopy

    • Super-resolution imaging: To detect nanoscale rearrangements of postsynaptic density components

  • In vivo approaches:

    • Viral-mediated gene delivery: For region-specific manipulation of Cnih2 expression

    • Conditional knockout models: For temporal control of Cnih2 deletion

    • Behavioral correlates: Assessing learning and memory tasks that depend on synaptic plasticity

  • Analytical considerations:

    • Include appropriate controls for developmental effects

    • Consider cell-type specific manipulations using Cre-driver lines

    • Account for potential compensatory mechanisms by other auxiliary proteins

These approaches collectively allow researchers to determine how Cnih2 influences the molecular machinery underlying synaptic plasticity, potentially revealing novel therapeutic targets for cognitive disorders.

How can computational modeling integrate Cnih2 structural data with functional outcomes at the receptor level?

Computational modeling offers powerful tools to bridge structural insights about Cnih2 with its functional effects on AMPAR dynamics. A comprehensive modeling approach should include:

  • Molecular dynamics (MD) simulations:

    • All-atom simulations: To model detailed Cnih2-AMPAR interactions in a membrane environment

    • Parameters to analyze: Hydrogen bonding patterns, electrostatic interactions, conformational changes upon binding

    • Time scales: Extended simulations (microsecond range) to capture slower conformational changes

    • Membrane considerations: Include appropriate lipid composition to mimic neuronal membranes

  • Kinetic modeling of AMPAR gating:

    • Develop Markov models incorporating states for:

      • Closed, open, and desensitized conformations

      • Multiple intermediate states influenced by Cnih2 binding

    • Parameterize using electrophysiological data from various conditions

    • Validate with predictions of receptor behavior under novel conditions

  • Integration with structural data:

    • Use cross-linking data to define distance restraints

    • Incorporate cryo-EM density maps as spatial constraints

    • Validate models against mutagenesis experiments at the interaction interface

  • Multi-scale modeling approaches:

    • Connect atomic-level interactions to mesoscale receptor clustering

    • Model effects on receptor lateral diffusion in the membrane

    • Simulate synaptic integration of AMPAR currents modified by Cnih2

  • Practical implementation recommendations:

    • Software packages: GROMACS or NAMD for MD simulations

    • Enhanced sampling techniques: Umbrella sampling or metadynamics to overcome energy barriers

    • Computing resources: GPU acceleration or distributed computing for adequate sampling

These computational approaches can generate testable hypotheses about how specific structural features of Cnih2 translate to its effects on AMPAR gating, trafficking, and ultimately synaptic function.

What are the implications of Cnih2 dysfunction in neurological disorders, and how can recombinant Cnih2 be used to study these conditions?

Emerging evidence suggests potential links between Cnih2 dysfunction and various neurological disorders, given its critical role in AMPAR regulation. Recombinant Cnih2 provides valuable tools for investigating these connections:

  • Neurodevelopmental disorders:

    • Given AMPARs' crucial role in synapse development, Cnih2 dysfunction may contribute to conditions like autism spectrum disorders

    • Recombinant Cnih2 can be used to reconstitute receptor complexes with variants identified in patient populations

    • Key approaches include comparing wild-type versus variant Cnih2 effects on AMPAR trafficking and electrophysiological properties

  • Epilepsy research applications:

    • Altered AMPAR function is implicated in epileptogenesis

    • Researchers can use recombinant Cnih2 to investigate how its modulation of receptor kinetics might influence neuronal hyperexcitability

    • Combining Cnih2 manipulations with seizure models can reveal potential therapeutic targets

  • Neurodegeneration models:

    • In conditions like Alzheimer's disease, AMPAR trafficking is disrupted

    • Recombinant Cnih2 can be used to examine interactions with disease-associated proteins

    • Studies could investigate whether enhancing or inhibiting Cnih2 function might restore normal AMPAR dynamics

  • Pain processing:

    • AMPARs in spinal cord circuits contribute to nociceptive processing

    • Recombinant Cnih2 can help elucidate region-specific roles in pain pathways

    • Potential for identifying novel analgesic targets

  • Methodological approaches:

    • iPSC-derived neurons: Study Cnih2 function in patient-derived cellular models

    • Slice culture electrophysiology: Examine effects of recombinant Cnih2 application on circuit function

    • Viral-mediated gene delivery: For in vivo studies using recombinant Cnih2 constructs

By connecting molecular mechanisms to disease phenotypes, this research may ultimately identify Cnih2 as a potential therapeutic target for neurological disorders characterized by altered glutamatergic signaling.

How can recombinant Cnih2 constructs be engineered for pathway-specific modulation of AMPAR function?

Engineering recombinant Cnih2 constructs with enhanced specificity offers opportunities for precise modulation of AMPAR function in targeted neural pathways. Several strategic approaches can be considered:

  • Domain-specific modifications:

    • Extracellular loop variants: Engineer mutations in the unique sequences that distinguish Cnih2 from other cornichon homologs to alter AMPAR binding affinity or subtype selectivity

    • Transmembrane domain modifications: Alter residues that influence membrane topology or receptor interactions

    • Truncation constructs: Generate versions lacking specific domains to create potential dominant-negative effects

  • Cell-type targeting strategies:

    • Promoter selection: Use cell-type specific promoters (e.g., CaMKII for excitatory neurons) in viral vectors

    • Conditional expression systems: Implement Cre-dependent expression for spatial and temporal control

    • Activity-dependent expression: Engineer promoters responsive to neuronal activity patterns

  • Subcellular targeting approaches:

    • Fusion with targeting motifs: Append sequences that direct Cnih2 to specific compartments (dendrites, dendritic spines, etc.)

    • PDZ-binding motifs: Enhance or disrupt interactions with scaffolding proteins

    • Retention/retrieval signals: Modify trafficking to alter ER retention versus surface expression

  • Functional engineering:

    • Chemogenetic approaches: Incorporate domains that respond to exogenous ligands for inducible modulation

    • Optogenetic integration: Engineer light-sensitive domains to control Cnih2-AMPAR interactions with temporal precision

    • FRET-based sensors: Create chimeric constructs that report on binding events or conformational changes

  • Validation approaches:

    • Confirm target engagement using biochemical assays

    • Verify functional effects with electrophysiology

    • Assess pathway specificity using circuit mapping techniques

These engineered constructs can serve as both research tools and potential therapeutic prototypes, enabling precise manipulation of glutamatergic signaling in specific neural circuits implicated in neurological and psychiatric disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.