Recombinant Rat Protein cornichon homolog 3 (Cnih3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Protein Cornichon Homolog 3 (Cnih3)

Recombinant Rat Protein Cornichon Homolog 3 (Cnih3) is a protein derived from the Cornichon family, specifically designed for research purposes. Cornichon homologs, including CNIH-3, are known to interact with AMPA-type glutamate receptors (AMPARs), playing a crucial role in modulating their ion channel function and trafficking . This article will delve into the details of Recombinant Rat Protein Cnih3, its functions, and relevant research findings.

Function and Role of CNIH-3

CNIH-3 is part of the Cornichon family, which includes proteins that form stable complexes with AMPARs. These complexes contribute to the transmembrane density of AMPARs and are essential for their proper functioning . CNIH-3, in particular, enhances the surface expression of AMPARs, slows their deactivation, and reduces desensitization, thereby modulating synaptic transmission .

Research Findings on CNIH-3

Research on CNIH-3 has shown that it interacts with AMPARs through conserved membrane-proximal residues and unique sequences in its extracellular loop . This interaction is crucial for the modulation of AMPAR gating properties. Studies have also identified sex-specific effects of CNIH3 on spatial memory and synaptic plasticity, highlighting the complexity of its role in neurological functions .

Recombinant Rat Protein Cnih3

Recombinant Rat Protein Cnih3 is a partial protein used in research to study the functions and interactions of CNIH-3 with AMPARs. It is produced using recombinant DNA technology, allowing for controlled expression and purification of the protein for experimental purposes .

Data and Tables

While specific data tables for Recombinant Rat Protein Cnih3 are not readily available, research findings on CNIH-3's interaction with AMPARs and its role in neurological functions are summarized below:

PropertyDescription
Protein FamilyCornichon homologs
FunctionModulates AMPAR ion channel function and trafficking
InteractionForms stable complexes with AMPARs
Role in NeurologyInfluences synaptic transmission and spatial memory
Sex-Specific EffectsIdentified in spatial memory and synaptic plasticity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. Please specify your required tag type for preferential development.
Synonyms
Cnih3; Protein cornichon homolog 3; CNIH-3; Cornichon family AMPA receptor auxiliary protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Cnih3
Target Protein Sequence
MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERI CFLLRKLVLPEYSIHSLFCVMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPP VVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
Uniprot No.

Target Background

Function
Recombinant Rat Protein cornichon homolog 3 (Cnih3) regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). It facilitates their membrane and synaptic targeting, modulating their gating kinetics (activation, deactivation, and desensitization).
Gene References Into Functions
  1. Studies have identified residues in the CNIHs' membrane-proximal region crucial for AMPAR binding, and a segment within the CNIH-2/3 extracellular loop essential for both physical interaction and AMPAR gating modulation. PMID: 25186755
Database Links
Protein Families
Cornichon family
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Note=Also localizes to the cell membrane of extrasynaptic sites (dendritic shafts, spines of pyramidal cells).
Tissue Specificity
Brain. Expressed in the neocortex, hippocampal formation, and cerebellum (at protein level).

Q&A

What is Cornichon Homolog 3 (CNIH3) and what is its primary function?

CNIH3 is an AMPA receptor (AMPAR) auxiliary protein that plays two crucial roles in neuronal function: trafficking AMPARs to the postsynaptic membrane and potentiating AMPAR signaling . As a key component in the AMPAR complex, CNIH3 modulates synaptic function by influencing receptor kinetics and surface expression. Research has demonstrated that CNIH3 directly interacts with AMPARs, which are fundamental to hippocampal synaptic plasticity and memory formation processes . The protein is notably concentrated in the dorsal hippocampus, a region strongly associated with spatial learning and memory functions .

How does CNIH3 differ from other AMPAR auxiliary proteins?

While several auxiliary proteins modulate AMPAR function, CNIH3 has distinctive characteristics in trafficking and potentiating AMPARs. Unlike transmembrane AMPAR regulatory proteins (TARPs), CNIH3 appears to have unique effects on receptor gating kinetics and shows differential regional expression patterns . Additionally, CNIH3 functions distinctly from its homolog CNIH2, as studies demonstrate that CNIH2 expression levels remain unchanged even when CNIH3 is knocked down or knocked out, suggesting non-redundant functions despite their similarity . This functional specificity makes CNIH3 particularly interesting for targeted studies of AMPAR-mediated processes.

What are the known expression patterns of CNIH3 in the rat brain?

CNIH3 shows concentrated expression in specific brain regions, with particularly high levels observed in the dorsal hippocampus . Within hippocampal subregions, CNIH3 expression has been detected in excitatory neurons, where it co-localizes with AMPARs at postsynaptic densities . Immunohistochemistry techniques using myc-tagged CNIH3 protein have confirmed this localization pattern in virally transduced neurons . The regional specificity of CNIH3 expression correlates with its functional role in spatial memory processes, as the dorsal hippocampus is a critical structure for spatial learning and memory formation.

What are the sex-specific effects of CNIH3 on spatial memory, and what mechanisms might underlie these differences?

Research has revealed remarkable sex-specific effects of CNIH3 on spatial memory. Female Cnih3-/- mice display significant impairments in spatial memory tasks, making more primary errors, showing higher primary latency, and taking less efficient routes to targets in the Barnes maze compared to wild-type females . Conversely, female mice overexpressing CNIH3 in the dorsal hippocampus demonstrate enhanced spatial memory, with fewer errors, lower primary latency, and more efficient navigation strategies .

Intriguingly, these effects are sex-specific, as male Cnih3 knockout or overexpression mice show no significant changes in spatial memory performance compared to wild-type males . The mechanisms underlying these sex differences likely involve interactions between CNIH3 and estrogen-responsive pathways, as transcriptomic analyses reveal that Cnih3 deletion results in broader transcriptomic differences between estrous cycle stages in females . This suggests CNIH3 may play a regulatory role in estrogen-mediated modulation of synaptic plasticity in the female hippocampus, potentially through effects on AMPAR trafficking that are influenced by hormonal states.

How does CNIH3 interact with the estrous cycle to affect hippocampal function?

CNIH3 exhibits complex interactions with the estrous cycle that affect hippocampal function at molecular, cellular, and behavioral levels. Transcriptomic analyses of the dorsal hippocampus from wild-type and Cnih3 knockout females across different estrous stages reveal that Cnih3 deletion dramatically amplifies transcriptional responses to the estrous cycle . While wild-type mice show up to 1000 differentially expressed genes (DEGs) between different estrous stages, Cnih3 knockout mice display even broader transcriptomic differences .

These estrous-responsive genes are particularly enriched in oligodendrocyte markers, dentate gyrus markers, and functional gene sets related to estrogen response, potassium channels, and synaptic gene splicing . The accentuated transcriptional responses in Cnih3 knockouts suggest that CNIH3 normally functions to moderate or buffer estrous cycle-dependent gene expression in the hippocampus. This molecular evidence aligns with behavioral and physiological findings showing estrous stage-specific effects of Cnih3 deletion on learning, memory, and synaptic plasticity .

What are the implications of CNIH3 research for understanding sex differences in learning and memory disorders?

The sex-specific effects of CNIH3 on spatial memory and hippocampal function have significant implications for understanding sex differences in learning and memory disorders. The finding that CNIH3 function affects females differently than males highlights the importance of considering sex as a biological variable in neuroscience research .

These findings may help explain why certain neurological and psychiatric conditions that involve learning and memory deficits show sex-based prevalence differences or symptom manifestations. For instance, disorders involving AMPAR dysfunction might present differently in males versus females due to interactions with sex-specific neuromodulatory systems like those involving estrogen.

From a therapeutic perspective, CNIH3 research suggests that treatments targeting AMPAR function may need sex-specific approaches. The estrous-dependent effects of CNIH3 also indicate that hormonal state should be considered when developing therapeutic strategies for cognitive disorders in females . This research underscores the need for preclinical studies that include both sexes and account for estrous/menstrual cycle effects when investigating memory-related conditions.

What are the optimal methods for generating and validating CNIH3 knockout models?

Creating reliable CNIH3 knockout models requires careful genetic engineering and thorough validation. Based on published research, an effective approach involves:

  • Gene targeting strategy: The most successful method used a "knockout-first" allele design, targeting exon 4 of the Cnih3 gene. This approach starts with C57BL/6 Cnih3 tm1a(KOMP)Wtsi mice from the Knockout Mouse Project (KOMP) .

  • Breeding protocol: The recommended multi-stage breeding process includes:

    • Backcrossing heterozygous male C57BL/6N mice with wild-type female C57BL/6J mice

    • Breeding heterozygous offspring to generate wild-type, heterozygous, and homozygous tm1a Cnih3 mice

    • For complete knockout: Breeding homozygote males with Actin-FLPe females to excise the Splice Acceptor site and other cassettes (F1 generation)

    • Breeding male F1 mice with Actin-Cre females to excise exon 4 (F2 generation)

  • Validation techniques: Critical validation steps include:

    • RT-qPCR analysis to confirm reduced mRNA expression (targeting exon 4)

    • Western blot analysis of CNIH3 protein levels

    • Assessment of potential compensatory expression of related genes (e.g., Cnih2)

During validation, researchers should be aware that initial tm1a(KOMP)Wtsi designs might result in knockdown rather than complete knockout (as observed in the referenced study, which showed only 60% reduction in exon 4 expression) . A complete knockout requires additional breeding steps to remove exon 4 entirely, creating a frameshift mutation leading to nonsense-mediated decay .

What are the key considerations for designing behavioral experiments to study CNIH3's effects on spatial memory?

When designing behavioral experiments to investigate CNIH3's effects on spatial memory, researchers should consider the following methodological factors:

  • Sex as a biological variable: Given the sex-specific effects of CNIH3, experiments must include both male and female subjects with sufficient sample sizes to detect sex differences . Statistical analyses should be structured to compare within and between sexes.

  • Estrous cycle monitoring: For female subjects, tracking the estrous cycle is essential as CNIH3 effects vary across different cycle stages . Methods include vaginal cytology to categorize subjects into proestrus, estrus, metestrus, and diestrus phases.

  • Spatial memory paradigm selection: The Barnes maze has proven effective for assessing CNIH3-related spatial memory effects . Key parameters to measure include:

    • Primary errors (number of incorrect holes checked)

    • Primary latency (time to reach target)

    • Path efficiency (ratio of shortest possible path to actual path taken)

  • Control groups: Appropriate controls should include:

    • Wild-type littermates (sex-matched)

    • Heterozygous animals to assess gene dosage effects

    • For overexpression studies: control vector expression (e.g., YFP)

  • Training protocol standardization: A recommended protocol based on successful studies includes:

    • 4 days of training (4 trials per day)

    • 90-second trial duration

    • 30-second target exploration period

    • 15-minute inter-trial interval

  • Environmental consistency: Maintaining consistent testing conditions is crucial, including time of day, lighting, temperature, and olfactory cues, as these can influence spatial memory performance independent of genetic factors.

What techniques are most effective for viral-mediated CNIH3 overexpression in the dorsal hippocampus?

For effective viral-mediated CNIH3 overexpression in the dorsal hippocampus, the following technical approach is recommended:

  • Viral vector design:

    • AAV5 serotype has demonstrated efficacy for hippocampal gene delivery

    • Expression driven by the CaMKIIα promoter ensures targeting of excitatory neurons

    • Inclusion of a myc tag facilitates detection of the overexpressed protein

    • The construct should contain wild-type Cnih3 cDNA sequence

  • Surgical delivery protocol:

    • Stereotaxic coordinates for dorsal hippocampus targeting

    • Bilateral injections (0.5-1 μl per site) at a rate of 0.1 μl/minute

    • Allow 2-3 weeks for optimal expression before behavioral testing

  • Expression validation:

    • Immunohistochemistry using anti-myc antibodies (e.g., Cell Signaling Technology #2272)

    • Visualization with fluorescent secondary antibodies (e.g., goat anti-rabbit 594 Alexa Fluor)

    • Confocal microscopy to confirm expression in the target region

  • Controls:

    • YFP-expressing vector in age and sex-matched animals

    • Sham surgery controls to account for surgical effects

    • Validation of expression levels through RT-qPCR and/or Western blotting

This approach allows for targeted overexpression of CNIH3 specifically in excitatory neurons of the dorsal hippocampus, enabling the study of region-specific effects on spatial memory and other cognitive functions.

How should researchers interpret contradictory findings in male versus female subjects in CNIH3 research?

When faced with contradictory findings between male and female subjects in CNIH3 research, researchers should implement the following analytical framework:

  • Biological context integration: Rather than viewing sex differences as contradictions, interpret them as biologically meaningful variations that reflect underlying neurobiological differences. Consider that CNIH3 functions within sex-specific molecular contexts, particularly in relation to gonadal hormone signaling .

  • Estrous cycle stratification: For female subjects, data should be stratified by estrous cycle stage when analyzing results, as CNIH3 effects vary significantly across the cycle . Failure to account for cycle stage can lead to increased variability and potentially mask or exaggerate effects.

  • Statistical approaches:

    • Employ multi-factor ANOVA designs that include sex, genotype, and estrous stage as factors

    • Test for interaction effects that specifically address sex differences

    • Consider non-parametric analyses when appropriate, particularly for behavioral data with non-normal distributions

  • Mechanistic reconciliation: When differences occur, explore mechanisms that might explain the divergence:

    • Investigate interactions between CNIH3 and estrogen signaling pathways

    • Examine potential compensatory mechanisms that may be sex-specific

    • Consider differential expression of CNIH3 or AMPARs between sexes

  • Reporting standards: Explicitly report all negative and positive findings across sexes, avoiding the tendency to focus only on significant results. This transparency is essential for building a complete understanding of CNIH3 biology.

What approaches are recommended for analyzing transcriptomic data in CNIH3 studies across different estrous cycle stages?

Analyzing transcriptomic data in CNIH3 studies across estrous cycle stages requires specialized approaches to accurately capture the complex interactions between genotype and hormonal state:

  • Experimental design considerations:

    • Include sufficient biological replicates (n≥3-4) for each estrous stage and genotype combination

    • Match samples for time of day to control for circadian effects

    • Process all samples in parallel to minimize batch effects

  • Differential expression analysis workflow:

    • Employ robust normalization methods appropriate for RNA-seq data (e.g., DESeq2, edgeR)

    • Perform pairwise comparisons between estrous stages within each genotype

    • Conduct genotype comparisons within each estrous stage

    • Use multiple testing correction (e.g., Benjamini-Hochberg) with appropriate thresholds

  • Interpretive strategies:

    • Compare the number of differentially expressed genes (DEGs) between different estrous stages in wild-type versus Cnih3 knockout animals

    • Focus on genes showing genotype × estrous stage interactions

    • Examine enriched biological pathways using tools like Gene Ontology or KEGG pathway analysis

    • Analyze cell-type-specific gene expression patterns using established marker genes

  • Validation approaches:

    • Confirm key findings with qRT-PCR on independent samples

    • Correlate transcriptomic changes with protein-level changes where possible

    • Connect transcriptomic findings to observed behavioral or electrophysiological phenotypes

This methodical approach allows researchers to disentangle the complex relationships between CNIH3 function, estrous cycle stage, and gene expression in the hippocampus.

How can researchers effectively compare and contrast CNIH3 knockout versus overexpression models?

Comparing CNIH3 knockout and overexpression models presents unique challenges and opportunities for understanding this protein's function. The following analytical framework is recommended:

  • Reciprocal phenotype analysis:

    • Systematically evaluate whether phenotypes in knockout models are reversed in overexpression models

    • Focus on parameters showing the most robust effects in each model type

    • For example, in females, analyze whether spatial memory deficits in knockouts correspond to enhancements in overexpression models

  • Dose-response considerations:

    • Include heterozygous knockout animals to assess gene dosage effects

    • For overexpression, consider using promoters of varying strengths to create a range of expression levels

    • Quantify CNIH3 expression levels and correlate with phenotypic measures to establish dose-response relationships

  • Regional specificity analysis:

    • Compare global knockout effects to region-specific (e.g., dorsal hippocampus) overexpression

    • Consider creating region-specific knockouts using conditional approaches for more direct comparisons

    • Analyze whether observed differences might reflect developmental versus acute roles of CNIH3

  • Mechanistic pathway investigation:

    • For key phenotypes, investigate whether the same molecular pathways are affected in opposite directions in knockout versus overexpression models

    • Focus on AMPAR trafficking, composition, and signaling pathways

    • Consider broader effects on transcriptional regulation, particularly in relation to estrous cycle-dependent gene expression

This comprehensive comparison approach allows researchers to distinguish direct effects of CNIH3 from compensatory or developmental adaptations, providing deeper insights into its functional roles.

What are promising areas for investigating CNIH3's potential therapeutic applications in memory disorders?

Given CNIH3's demonstrated role in spatial memory and its sex-specific effects, several promising research directions exist for therapeutic applications:

  • Sex-specific cognitive enhancers: Since CNIH3 overexpression enhances spatial memory specifically in females, investigating compounds that increase CNIH3 expression or mimic its effects on AMPAR trafficking could lead to female-specific cognitive enhancers . These might be particularly relevant for conditions with female predominance or for addressing cognitive decline in postmenopausal women.

  • Hormone-responsive cognitive therapies: The interaction between CNIH3 and the estrous cycle suggests potential for developing cognitive therapies that account for hormonal status. Research should explore whether CNIH3-targeting approaches could be optimized by timing administration according to menstrual/estrous cycle phases or by combining them with hormone replacement therapies .

  • AMPAR trafficking modulation: Rather than targeting CNIH3 directly, developing compounds that enhance AMPAR surface expression through alternate trafficking pathways might compensate for CNIH3 deficiency. This approach could benefit conditions characterized by reduced AMPAR function regardless of the underlying cause.

  • Cell-type specific interventions: Given that estrous-responsive genes modulated by CNIH3 are enriched in specific cell types like oligodendrocytes and dentate gyrus neurons , developing cell-type targeted approaches could enhance therapeutic specificity and reduce off-target effects.

What techniques are emerging for studying CNIH3-AMPAR interactions at the molecular level?

Advanced techniques for investigating CNIH3-AMPAR interactions at the molecular level include:

  • Cryo-electron microscopy (Cryo-EM): This technique allows visualization of the CNIH3-AMPAR complex structure at near-atomic resolution, providing insights into binding interfaces and conformational changes that influence receptor kinetics and trafficking.

  • Single-molecule imaging approaches: Techniques such as single-particle tracking can monitor CNIH3-AMPAR complexes in live neurons, revealing dynamics of assembly, trafficking, and synaptic insertion with unprecedented resolution.

  • Optogenetic and chemogenetic control: These approaches enable temporal control of CNIH3 function through light-sensitive or drug-responsive protein variants, allowing researchers to probe acute versus chronic roles of CNIH3 in AMPAR trafficking and function.

  • Proximity labeling proteomics: Methods like BioID or APEX2 can identify proteins that interact with CNIH3 in specific cellular compartments, helping map the broader interactome that influences CNIH3-mediated AMPAR trafficking.

  • CRISPR-based approaches: These techniques allow precise genome editing to introduce specific mutations or tagged versions of CNIH3, enabling study of structure-function relationships and visualization of endogenous protein.

These emerging techniques promise to provide deeper insights into the molecular mechanisms underlying CNIH3's effects on AMPAR function and potentially identify new therapeutic targets.

How might CNIH3 research inform our understanding of sex differences in other neurological processes?

The sex-specific effects of CNIH3 on spatial memory and hippocampal function have broader implications for understanding sex differences across neurological processes:

  • Conceptual framework development: CNIH3 research provides a model for how auxiliary proteins can interact with sex hormone signaling to create sexually dimorphic effects on neural function without necessarily showing sex differences in baseline expression . This framework could be applied to investigate other proteins with potential sex-specific roles.

  • Methodological approaches: The comprehensive methods used to uncover CNIH3's sex-specific effects—combining behavioral, electrophysiological, biochemical, and transcriptomic approaches—provide a template for investigating sex differences in other neurological processes .

  • Translational insights: The finding that CNIH3 deletion affects learning in a sex-specific manner raises the possibility that other cognitive and neurological disorders may similarly have sex-specific molecular underpinnings . This could inform personalized approaches to treating conditions like Alzheimer's disease, depression, and epilepsy, which show sex differences in prevalence or presentation.

  • Developmental considerations: Future research should examine whether CNIH3's sex-specific effects emerge during particular developmental windows, which could inform broader understanding of how and when sex differences in neurological processes become established.

By elucidating how a single protein can have dramatically different effects between males and females, CNIH3 research highlights the importance of considering sex as a biological variable in all neuroscience research and suggests mechanisms through which sex differences might arise in diverse neurological processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.