Recombinant Rat Protein FAM134A (Fam134a)

Shipped with Ice Packs
In Stock

Description

General Information

  • Function: Fam134a functions as an ER-phagy receptor involved in collagen quality control . It facilitates the selective degradation of misfolded pro-collagen I, ensuring proper ER function and preventing the accumulation of potentially toxic proteins .

  • Paralogs: Fam134a belongs to the FAM134 protein family, which includes FAM134B and FAM134C . These paralogs have overlapping yet distinct roles in ER remodeling and ER-phagy .

  • LIR Domain: A conserved LIR (LC3-interacting region) domain is present in FAM134A, suggesting its importance for activity. FAM134A and FAM134C can bind to all six mATG8 proteins to differing extents, and mutation of the LIR motif in FAM134A and FAM134C or mutation of the classical binding site on LC3B is sufficient to abolish this interaction .

Research Findings

  • ER Remodeling: FAM134A plays a role in governing ER shape and homeostasis .

  • Collagen Quality Control: FAM134A is involved in the degradation of misfolded pro-collagen I . Overexpression of Fam134a in Fam134b or Fam134c knockout MEFs is sufficient to reduce pro-Collagen I to wild-type levels .

  • Compensation for Fam134b Loss: Fam134a can compensate for the loss of Fam134b in certain contexts . Overexpression of wild-type or ΔLIR mutant Fam134a was able to rescue the pro-Collagen-I accumulation in Fam134b knockout cells .

  • Interaction with GABARAP Proteins: FAM134A shows a slight interaction with GABARAP proteins .

FAM134A in Relation to FAM134B and FAM134C

The FAM134 family consists of three paralogs: FAM134A, FAM134B, and FAM134C. While all three proteins are involved in ER-phagy, they exhibit distinct functions and interactions :

  • FAM134B: Required for protein secretion in chondrocytes, cartilage growth, and bone mineralization in medaka fish . Loss-of-function mutations in FAM134B are associated with hereditary sensory and autonomic neuropathy (HSAN) .

  • FAM134C: May act as a co-receptor or enhancer in Fam134b-dependent ER-phagy of misfolded pro-Collagen I . Overexpression of Fam134c in Fam134a knockout MEFs only partially reverted the high Collagen I levels and did not rescue the Collagen I accumulation in Fam134b knockout MEFs .

Significance

Understanding the role of Fam134a and its paralogs in ER-phagy has significant implications for various fields:

  • Neurodegenerative Diseases: Defects in ER-phagy and ER remodeling are linked to neurodegenerative disorders .

  • Collagen-Related Diseases: Given its role in collagen quality control, Fam134a may be relevant to diseases involving collagen dysfunction .

  • Cellular Homeostasis: ER-phagy is crucial for maintaining cellular health by removing damaged or unnecessary ER components .

Further Research

Further research is needed to fully elucidate the mechanisms and regulatory pathways involving Fam134a. Key areas for future investigation include:

  • Regulation of FAM134A Expression: Identifying the factors that regulate FAM134A expression and activity will provide insights into its role in ER-phagy .

  • Interaction with Other Proteins: Further exploration of FAM134A's interactions with other proteins, such as GABARAP proteins, may reveal additional functions and regulatory mechanisms .

  • In vivo Studies: Conducting in vivo studies to investigate the role of Fam134a in different tissues and disease models will provide a more comprehensive understanding of its physiological relevance .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Retreg2; Fam134a; Reticulophagy regulator 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Retreg2
Target Protein Sequence
MASSGGGNTGAGGTSGLGLGLGLGLCMGEATGDAEEEAAAAEAVGRLATSLWLRLRGWEA VLAAAQRLLVWEKPLHSLVTAATLNGLFWLLSSSSLRPFFLLSISLLTYFLLDLWHPRFL PDVSAPPPEEPHSDSEGAGSGAQPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQ FCARVCSGCAVLAVLGHYVPGIMISYIVLLSILLWPLVVYHELIQRMYTRLEPLLMQLDY SMKAEADALHHKHDKRKRQGKNAPPAGDEPLAETESESEAELAGFSPVVDVKKTALALAI TDSELSDEEASILESGGFSVSRATTPQLTDVSEDLDQQSLPSEPEEALSRELGDGEETEL APPEDLLSAPPALSKQALDTEEEGAADKETLLQLSSPLHFVNTHFNGAGSPQEGVKCPPG GPVETLSPEAVSGDLMAPSSTLSPQLCLAESGPVTLLSPSVLPSLPQDSPQALTAPEEEE ALTTEDFELLDQGELEQLNAELGLGPEMPPKPPDVLPPPPLGPDSHSLVQSDQEAHAVVE P
Uniprot No.

Target Background

Database Links
Protein Families
RETREG family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FAM134A and what is its role in cellular processes?

FAM134A is a member of the FAM134 protein family, which includes FAM134B and FAM134C. These proteins function as endoplasmic reticulum (ER)-phagy receptors involved in ER remodeling and quality control of proteins. FAM134A contains a conserved LC3-interacting region (LIR) domain that enables it to bind to ATG8 proteins, facilitating the selective degradation of ER components through autophagy . The protein plays a critical role in maintaining ER homeostasis, particularly in response to cellular stress conditions. Unlike its paralog FAM134B, which has been more extensively studied, FAM134A's specific functions are still being elucidated, though evidence suggests it may have unique roles in protein quality control mechanisms .

How does FAM134A differ from other members of the FAM134 family?

The FAM134 family comprises three members: FAM134A, FAM134B, and FAM134C. While they share structural similarities, particularly in their LIR domain regions, they exhibit distinct functional properties:

FeatureFAM134AFAM134BFAM134C
Size (aa)541Variable (multiple isoforms)Similar to FAM134A
LIR domainPresent, functionalPresent, functionalPresent, functional
ATG8 bindingBinds all six mATG8 proteinsPreferential binding to certain ATG8sBinds all six mATG8 proteins
RegulationLess characterizedRegulated by TFEB/TFE3 transcription factorsLess characterized
Tissue expressionBroad distributionEnriched in certain tissues including cartilageBroad distribution
Role in diseaseUnder investigationMutations linked to sensory neuropathyUnder investigation

The most conserved feature among the three FAM134 proteins is the LIR domain region, suggesting its evolutionary importance for their function as ER-phagy receptors . While FAM134B has been extensively studied in the context of FGF18 signaling and bone development, the specific roles of FAM134A and FAM134C are still being characterized in various physiological contexts .

What is the mechanism of FAM134A-mediated ER-phagy and how does it differ from FAM134B-mediated processes?

FAM134A mediates ER-phagy through a mechanism that involves selective recognition and degradation of ER components. The process includes:

  • Recognition Phase: FAM134A, embedded in the ER membrane through its reticulon-like domain, recognizes and binds to specific ER regions targeted for degradation.

  • Autophagy Machinery Recruitment: Through its LIR motif, FAM134A interacts with ATG8 family proteins (including LC3B), as demonstrated by pull-down experiments with purified GST-mATG8s . This interaction is critical, as mutation of the LIR motif in FAM134A or mutation of the classical binding site on LC3B abolishes this interaction .

  • Membrane Remodeling: FAM134A likely contributes to ER membrane remodeling and fragmentation, facilitating the sequestration of ER portions into autophagosomes.

  • Selective Degradation: The FAM134A-bound ER fragments are directed to lysosomes for degradation.

In comparison to FAM134B-mediated processes:

  • While FAM134B is specifically induced by FGF18 signaling in chondrocytes through TFEB/TFE3 transcription factors , the transcriptional regulation of FAM134A remains less characterized.

  • FAM134B has been shown to have a critical role in cartilage growth and bone mineralization , whereas FAM134A's tissue-specific functions are still being investigated.

  • Both proteins interact with ATG8 family members through their LIR domains, but their substrate selectivity and downstream effects might differ based on tissue context and cellular conditions .

How do transcription factors regulate FAM134A expression and function?

While direct evidence for transcriptional regulation of FAM134A is limited in the provided search results, insights can be drawn from the regulation of its paralog FAM134B:

  • Potential MiT/TFE Factor Regulation: FAM134B is regulated by TFEB and TFE3 transcription factors, which bind to CLEAR sites in the gene . Given the structural and functional similarities between FAM134 family members, FAM134A might also be regulated by similar transcription factors.

  • Response to Cellular Stress: Like FAM134B, which is induced during nutrient starvation through TFEB/TFE3 activation , FAM134A expression might be modulated under specific stress conditions that activate autophagy.

  • Developmental Regulation: FAM134B transcription is influenced by developmental cues, particularly in the context of bone development . FAM134A might similarly be subject to developmental regulation in specific tissues.

  • Signaling Pathway Integration: The regulation of FAM134B by FGF18 suggests that growth factor signaling pathways can modulate ER-phagy receptor expression . Similar mechanisms might regulate FAM134A in response to different extracellular signals.

Research looking at TFEB/TFE3 binding sites within the FAM134A gene promoter or intronic regions, similar to the CLEAR site identified in FAM134B , would be valuable in understanding its transcriptional regulation.

What is the role of FAM134A in protein quality control and how does it select its substrates?

FAM134A functions as an ER-phagy receptor involved in protein quality control, particularly for complex proteins that require extensive folding in the ER. Recent evidence characterizes FAM134A as playing a role in collagen quality control, similar to its paralog FAM134C .

Substrate Selection Mechanisms:

  • Recognition of Misfolded Proteins: FAM134A likely recognizes regions of the ER containing accumulated misfolded proteins, though the precise molecular mechanisms of this recognition remain to be fully elucidated.

  • Interaction with ER Quality Control Machinery: FAM134A may collaborate with other ER quality control components to identify and segregate areas containing terminally misfolded proteins.

  • Formation of Protein Clusters: Research indicates that FAM134 proteins are involved in identifying protein clusters that need to be eliminated through selective autophagy . These clusters might represent aggregation-prone proteins that could be detrimental if allowed to accumulate.

  • Specialized Substrate Selection: Different FAM134 family members may have evolved to recognize distinct types of substrates. While FAM134B has been implicated in the quality control of secretory proteins in chondrocytes , FAM134A might have specialized roles in other cell types or for different protein classes.

The substrate selectivity of FAM134A represents an important area for future research, particularly in the context of diseases characterized by protein misfolding and ER stress.

What are the recommended protocols for using recombinant rat FAM134A protein in experimental settings?

When working with recombinant rat FAM134A protein for experimental applications, researchers should follow these methodological guidelines:

Storage and Reconstitution:

  • Store lyophilized protein at -20°C or -80°C to maintain stability.

  • Reconstitute at appropriate concentrations (typically 50-100 μg/mL) using a suitable buffer that maintains protein stability.

  • Avoid repeated freeze-thaw cycles by preparing working aliquots.

Experimental Applications:

  • Pull-down Assays: For investigating protein-protein interactions, particularly with ATG8 family proteins:

    • Use purified GST-tagged ATG8 proteins immobilized on glutathione beads

    • Incubate with recombinant FAM134A

    • Analyze binding through western blotting with specific antibodies

    • Include appropriate controls (e.g., LIR-mutant FAM134A)

  • Cell Culture Applications:

    • Determine optimal protein concentration through dose-response experiments

    • For cellular uptake studies, consider using labeled protein

    • When studying effects on autophagy, monitor autophagy markers like LC3-II levels and autophagic flux

  • ER-phagy Assays:

    • Utilize fluorescently-tagged ER markers to monitor ER morphology and fragmentation

    • Combine with inhibitors of lysosomal degradation to assess autophagic flux

    • Compare effects with FAM134B as a positive control for ER-phagy induction

  • Functional Rescue Experiments:

    • In cells with CRISPR/Cas9-mediated deletion of endogenous FAM134A

    • Introduce recombinant protein to assess rescue of phenotypic defects

    • Include appropriate controls (e.g., LIR-mutant versions)

When designing experiments, researchers should consider the concentration-dependent effects and the stability of the recombinant protein under experimental conditions.

How can researchers effectively analyze the interaction between FAM134A and autophagy machinery?

To thoroughly analyze the interaction between FAM134A and autophagy machinery, researchers should employ multiple complementary approaches:

In Vitro Interaction Studies:

  • GST Pull-down Assays: Use purified GST-mATG8 proteins to pull down FAM134A and analyze binding specificity to different ATG8 family members .

  • Surface Plasmon Resonance (SPR): Determine binding kinetics and affinity between FAM134A and individual ATG8 proteins.

  • Isothermal Titration Calorimetry (ITC): Measure thermodynamic parameters of the interaction.

Mutation Analysis:

  • LIR Motif Mutations: Generate mutations in the LIR motif of FAM134A and assess the impact on ATG8 binding .

  • ATG8 Binding Site Mutations: Mutate the binding pocket on LC3B or other ATG8 proteins and evaluate effects on FAM134A interaction .

Cellular Interaction Studies:

  • Co-immunoprecipitation: Examine endogenous interactions between FAM134A and components of the autophagy machinery.

  • Proximity Ligation Assay (PLA): Visualize protein-protein interactions in situ with high sensitivity.

  • Fluorescence Resonance Energy Transfer (FRET): Analyze dynamic interactions in living cells.

Functional Analysis:

  • ER-phagy Assays: Compare ER-phagy efficiency in wild-type cells versus those expressing LIR-mutant FAM134A.

  • Autophagic Flux Measurement: Use tandem fluorescent-tagged LC3 (mRFP-GFP-LC3) to monitor autophagic flux in the presence of wild-type or mutant FAM134A.

  • Microscopy Analysis: Track the colocalization of FAM134A with LC3-positive structures during ER-phagy induction.

A comprehensive analysis would include both biochemical and cellular approaches to establish the molecular details and functional significance of the interaction between FAM134A and the autophagy machinery.

What approaches can be used to study FAM134A's role in ER remodeling and quality control?

To investigate FAM134A's role in ER remodeling and protein quality control, researchers can implement the following multifaceted approaches:

Imaging-based Methods:

  • Super-resolution Microscopy: Visualize ER membrane dynamics and FAM134A localization during ER remodeling events.

  • Live-cell Imaging: Track ER morphology changes in real-time using fluorescent ER markers in cells with modulated FAM134A expression.

  • Correlative Light and Electron Microscopy (CLEM): Combine fluorescence microscopy with ultrastructural analysis to examine FAM134A-mediated ER remodeling at nanoscale resolution.

Genetic Manipulation Strategies:

  • CRISPR/Cas9-mediated Gene Editing:

    • Generate FAM134A knockout cells or animals

    • Create specific domain deletions (e.g., FAM134A ΔLIR constructs) to dissect functional regions

    • Introduce point mutations to analyze structure-function relationships

  • RNA Interference:

    • Use siRNA or shRNA targeting FAM134A to achieve transient or stable knockdown

    • Examine consequent changes in ER morphology and protein quality control

Biochemical and Proteomic Approaches:

  • Proximity-based Labeling (BioID or APEX):

    • Identify proteins in close proximity to FAM134A in the ER membrane

    • Map the FAM134A interactome under different cellular conditions

  • Differential Proteomics:

    • Compare the ER proteome in wild-type versus FAM134A-deficient cells

    • Identify protein substrates that accumulate in the absence of FAM134A

  • Secretome Analysis:

    • Assess changes in protein secretion patterns in cells with altered FAM134A expression

    • Identify secretory proteins whose quality control depends on FAM134A function

Stress Response Assays:

  • ER Stress Inducers:

    • Challenge cells with tunicamycin, thapsigargin, or DTT

    • Compare ER stress responses between control and FAM134A-deficient cells

    • Monitor unfolded protein response (UPR) markers

  • Protein Aggregation Assays:

    • Introduce aggregation-prone proteins and assess their clearance

    • Compare the formation of protein clusters in control versus FAM134A-deficient cells

By combining these approaches, researchers can develop a comprehensive understanding of FAM134A's role in ER homeostasis, membrane dynamics, and protein quality control pathways.

How does FAM134A function compare across different species and model systems?

Understanding the evolutionary conservation and functional differences of FAM134A across species provides valuable insights into its fundamental biological roles. Here's a comparative analysis:

Cross-Species Conservation:

SpeciesFAM134A HomologyNotable FeaturesExperimental Models
Rat (Rattus norvegicus)Reference541 amino acids, conserved LIR domainPrimary rat cells, rat-derived cell lines
Mouse (Mus musculus)High (>90%)Functional conservation of ER-phagy roleMEFs, tissue-specific knockout models
Human (Homo sapiens)High (~85%)Similar domain organizationHeLa, U2-OS cell lines
Fish (e.g., Medaka)ModerateRole in development may be conservedDevelopmental studies, in vivo imaging
Lower vertebratesVariableBasic ER-phagy function likely conservedEmerging models for evolutionary studies

Functional Conservation and Divergence:

  • Conserved Features:

    • The LIR domain and its ability to interact with ATG8 proteins are highly conserved across species

    • Role in ER homeostasis appears to be a fundamental function

    • Basic mechanisms of interaction with the autophagy machinery

  • Species-Specific Adaptations:

    • Tissue-specific expression patterns may vary between species

    • Regulatory mechanisms might differ, particularly transcriptional control

    • Paralog-specific functions might have evolved differently

Experimental Model Considerations:

  • Cell Culture Systems:

    • Mouse embryonic fibroblasts (MEFs) have been used to confirm the conservation of FAM134A's LIR domain function across mammalian species

    • Human cell lines like HeLa and U2-OS have been employed to study general mechanisms of ER-phagy involving FAM134 family proteins

  • Animal Models:

    • While specific FAM134A knockout models are less reported in the literature, studies on FAM134B in fish models have revealed roles in cartilage growth and bone mineralization

    • Similar developmental roles for FAM134A might exist across vertebrate species

  • Translational Relevance:

    • The high conservation suggests that findings in rodent models may have relevance to human physiology

    • Species-specific differences should be considered when extrapolating functional findings

Understanding these cross-species similarities and differences is crucial when designing experiments and interpreting results across different model systems.

What are the emerging applications of FAM134A research in understanding disease mechanisms?

FAM134A research is revealing important connections to various disease mechanisms, particularly those involving ER stress and protein quality control defects:

Neurodegenerative Diseases:

  • Given the role of ER stress in neurodegenerative conditions, FAM134A dysfunction might contribute to pathogenesis through impaired clearance of misfolded proteins

  • While FAM134B mutations have been linked to hereditary sensory neuropathy, the role of FAM134A in neurological disorders remains an active area of investigation

  • Research methodologies should include neuronal cell models expressing disease-associated protein aggregates with modulated FAM134A expression

Developmental Disorders:

  • The FAM134 family has been implicated in bone development, with FAM134B playing a role in cartilage growth and bone mineralization

  • FAM134A might similarly contribute to developmental processes through its role in ER homeostasis in specific tissues

  • Investigation of FAM134A expression patterns during embryonic development could reveal critical developmental windows

Cancer Biology:

  • Altered ER-phagy has been implicated in cancer progression and therapeutic resistance

  • FAM134A's role in protein quality control might influence cancer cell survival under stress conditions

  • Analysis of cancer genomic databases for FAM134A alterations could identify potential cancer types where it plays a significant role

Secretory Cell Dysfunction:

  • Given the importance of ER homeostasis in secretory cells, FAM134A might be particularly relevant in diseases affecting:

    • Pancreatic β-cells (diabetes)

    • Salivary gland cells (Sjögren's syndrome)

    • Professional secretory cells of the immune system

Research Applications:

  • Disease Modeling:

    • Generate patient-derived induced pluripotent stem cells (iPSCs) with FAM134A mutations

    • Differentiate into relevant cell types to study disease mechanisms

  • Therapeutic Exploration:

    • Identify compounds that modulate FAM134A expression or function

    • Explore the potential of enhancing FAM134A-mediated ER-phagy in diseases characterized by protein aggregation

  • Biomarker Development:

    • Investigate whether FAM134A levels or post-translational modifications correlate with disease progression

    • Develop assays to monitor FAM134A-mediated ER-phagy as a potential biomarker

As research progresses, the connections between FAM134A dysfunction and specific disease mechanisms will likely become more evident, potentially opening new avenues for therapeutic intervention.

What is known about the interplay between FAM134A and growth factor signaling pathways?

The relationship between FAM134A and growth factor signaling represents an emerging area of research. While direct evidence specifically for FAM134A is limited in the provided search results, insights can be extrapolated from studies on its paralog FAM134B and general principles of ER-phagy regulation:

Growth Factor Signaling and FAM134 Regulation:

  • FGF Signaling Pathway:

    • FGF18 has been shown to significantly induce FAM134B expression in chondrocytes

    • The mechanism involves suppression of IRS1-PI3K downstream signaling

    • This leads to activation of TFEB/TFE3 transcription factors that promote FAM134B transcription

    • Given the structural similarities within the FAM134 family, FAM134A might be regulated by similar or different growth factor pathways

  • PI3K-AKT-mTORC1 Pathway:

    • In the case of FAM134B, inhibition of PI3K-AKT-mTORC1 signaling promotes nuclear translocation of TFEB/TFE3

    • These transcription factors then bind to a CLEAR site in the FAM134B gene

    • FAM134A might similarly be regulated through inhibition of mTORC1 signaling during cellular stress conditions

  • PDGF Signaling:

    • While specific evidence for PDGF regulation of FAM134A is not presented in the search results, PDGF-AA is known to activate similar downstream pathways as FGF18

    • This suggests potential cross-talk between PDGF signaling and FAM134A expression or function

Potential Molecular Mechanisms:

  • Transcriptional Regulation:

    • Growth factors likely modulate transcription factors that regulate FAM134A expression

    • Analysis of the FAM134A promoter for binding sites of transcription factors downstream of growth factor signaling would be informative

  • Post-translational Modifications:

    • Growth factor signaling cascades often result in phosphorylation events

    • FAM134A contains multiple potential phosphorylation sites that might be targeted by kinases downstream of growth factor receptors

    • Phosphoproteomic analysis of FAM134A under different growth factor stimulation conditions could reveal regulatory mechanisms

  • Functional Integration:

    • Growth factors regulate cell growth, proliferation, and differentiation

    • FAM134A-mediated ER-phagy might be coordinated with these processes to ensure appropriate ER expansion or remodeling

    • FAM134A might participate in quality control of growth factor receptors themselves through selective ER-phagy

Research Directions:

  • Comparative Analysis:

    • Examine FAM134A expression in response to various growth factors (FGF, PDGF, EGF, etc.)

    • Compare with FAM134B to identify shared and distinct regulatory mechanisms

  • Signaling Pathway Manipulation:

    • Use specific inhibitors of PI3K, AKT, mTOR, and other signaling components to dissect pathways regulating FAM134A

    • Employ CRISPR/Cas9 to knockout key signaling molecules and assess effects on FAM134A expression and function

  • Developmental Context:

    • Investigate how growth factor-mediated regulation of FAM134A contributes to tissue development and homeostasis

    • FAM134B's role in bone development suggests that FAM134A might have specific roles in other developmental contexts

Understanding the interplay between FAM134A and growth factor signaling could provide insights into how cells coordinate ER homeostasis with changing metabolic demands and developmental programs.

What are common challenges in FAM134A research and how can they be addressed?

Researchers working with FAM134A may encounter several challenges that can impact experimental outcomes. Here are common issues and recommended solutions:

Protein Stability and Detection Issues:

ChallengeSolutionMethodological Considerations
Poor antibody specificityValidate antibodies using knockout controlsUse multiple antibodies targeting different epitopes
Low endogenous expressionOptimize detection methodsConsider enrichment techniques before detection
Protein degradation during extractionOptimize lysis buffers and include protease inhibitorsPerform extraction at 4°C with appropriate inhibitors

Functional Redundancy with FAM134 Paralogs:

  • Challenge: Compensatory effects from FAM134B and FAM134C may mask FAM134A-specific phenotypes

  • Solution: Generate double or triple knockout models

  • Approach: Use CRISPR/Cas9 to systematically delete multiple FAM134 family members and assess specific versus redundant functions

Difficulty in Visualizing ER-phagy Events:

  • Challenge: ER-phagy is a dynamic process that can be challenging to capture

  • Solution: Employ advanced imaging techniques

  • Methods:

    • Use tandem fluorescent tags (e.g., mCherry-GFP-FAM134A) to track progression to lysosomes

    • Implement super-resolution microscopy to visualize membrane dynamics

    • Utilize electron microscopy to confirm autophagic structures

Variable Effects Across Cell Types:

  • Challenge: FAM134A function may vary between different cell types

  • Solution: Systematic comparison across multiple cell systems

  • Approach: Analyze expression levels, localization patterns, and functional outcomes in different cell types to identify context-specific roles

Technical Challenges with Recombinant Protein:

  • Challenge: Maintaining proper folding and functionality of recombinant FAM134A

  • Solution: Optimize expression and purification conditions

  • Considerations:

    • Test different tags and expression systems

    • Validate protein activity after purification through functional assays

    • Consider expressing specific domains rather than full-length protein for certain applications

What emerging technologies and approaches will advance FAM134A research?

The field of FAM134A research is poised to benefit from several cutting-edge technologies and innovative approaches:

Advanced Imaging Technologies:

  • CLEM (Correlative Light and Electron Microscopy): Combine fluorescence microscopy with ultrastructural analysis to visualize FAM134A-mediated ER remodeling at nanoscale resolution

  • Live-cell Super-resolution Microscopy: Track dynamic ER-phagy events in real-time with unprecedented detail

  • Lattice Light-Sheet Microscopy: Capture 3D dynamics of ER remodeling with minimal phototoxicity

  • Application: These techniques will reveal the spatiotemporal dynamics of FAM134A function during ER-phagy

Proximity Labeling Proteomics:

  • TurboID and miniTurbo: Rapidly label proteins in proximity to FAM134A in living cells

  • Split-BioID Approaches: Detect conditional interactions that occur only under specific cellular conditions

  • Application: Map the complete interactome of FAM134A at the ER membrane and identify novel binding partners and regulatory mechanisms

CRISPR-based Technologies:

  • CRISPR Activation/Interference (CRISPRa/CRISPRi): Modulate FAM134A expression levels without genetic modification

  • Base Editing and Prime Editing: Introduce precise mutations to study structure-function relationships

  • CRISPR Screens: Identify genes that synthetically interact with FAM134A

  • Application: These approaches will enable more nuanced manipulation of FAM134A and help identify its functional networks

Organoid and In Vivo Models:

  • Tissue-specific Organoids: Study FAM134A function in complex 3D tissue environments

  • Conditional Knockout Animals: Investigate tissue-specific roles in development and disease

  • Application: These models will reveal physiological roles of FAM134A beyond cell culture systems

Structural Biology Approaches:

  • Cryo-EM Analysis: Determine the structure of FAM134A in the ER membrane

  • Molecular Dynamics Simulations: Model how FAM134A interacts with and remodels membranes

  • Application: Structural insights will inform the design of specific modulators of FAM134A function

Single-cell Technologies:

  • Single-cell Transcriptomics: Profile FAM134A expression patterns across diverse cell types

  • Single-cell Proteomics: Analyze protein-level variations in FAM134A and its interactors

  • Application: These approaches will reveal cell-type specific roles and regulatory mechanisms

Computational and Systems Biology:

  • Machine Learning Algorithms: Predict functional outcomes of FAM134A variants

  • Network Analysis: Integrate FAM134A into broader cellular pathways

  • Application: These computational approaches will place FAM134A in the context of global cellular functions

By leveraging these emerging technologies, researchers will gain deeper insights into FAM134A's molecular mechanisms, physiological functions, and potential therapeutic applications.

How can researchers integrate FAM134A research with broader questions in cell biology?

FAM134A research connects to fundamental questions in cell biology and offers opportunities for integration with several major research areas:

ER Homeostasis and Stress Responses:

  • Research Integration: Investigate how FAM134A-mediated ER-phagy coordinates with other ER quality control mechanisms

  • Broader Impact: Understanding this coordination will reveal how cells maintain proteostasis under various stress conditions

  • Experimental Approach: Compare FAM134A-mediated responses with ERAD (ER-associated degradation) and UPR (unfolded protein response) in various stress contexts

Organelle Communication and Contact Sites:

  • Research Integration: Examine FAM134A's potential role at ER-lysosome or ER-mitochondria contact sites

  • Broader Impact: This will illuminate how selective autophagy connects to inter-organelle communication

  • Methodological Approach: Use proximity labeling at contact sites to identify FAM134A interactions with other organelle-specific proteins

Cell Development and Differentiation:

  • Research Integration: Study how FAM134A expression and function change during cellular differentiation

  • Broader Impact: This will reveal how ER remodeling contributes to specialized cell function acquisition

  • Research Direction: Track FAM134A during differentiation of stem cells into specialized cell types with varying secretory demands

Evolutionary Cell Biology:

  • Research Integration: Compare FAM134A function across evolutionary diverse organisms

  • Broader Impact: This will reveal how ER-phagy mechanisms evolved and adapted to different cellular contexts

  • Comparative Approach: Analyze FAM134A homologs from simple eukaryotes to mammals, focusing on structural and functional conservation

Tissue-specific Physiology:

  • Research Integration: Investigate FAM134A's role in tissues with high secretory burden

  • Broader Impact: This will connect cellular ER-phagy mechanisms to tissue-level physiology

  • Translational Potential: Focus on tissues relevant to specific diseases, such as pancreas (diabetes), cartilage (skeletal disorders), or neurons (neurodegeneration)

Systems Biology of Cellular Quality Control:

  • Research Integration: Position FAM134A within the broader network of cellular quality control mechanisms

  • Broader Impact: This will reveal how different quality control systems are coordinated

  • Network Approach: Map interactions between FAM134A-mediated ER-phagy and other quality control pathways using systems biology tools

Comparative Analysis with Other Selective Autophagy Pathways:

  • Research Integration: Compare mechanisms of FAM134A-mediated ER-phagy with other selective autophagy pathways

  • Broader Impact: Identify common principles and unique features of different selective autophagy processes

  • Cross-disciplinary Approach: Collaborate with researchers studying mitophagy, pexophagy, and other selective autophagy pathways

By integrating FAM134A research with these broader questions in cell biology, researchers can not only advance the specific understanding of this protein but also contribute to fundamental knowledge about cellular organization, adaptation, and homeostasis. This integrative approach will likely yield insights with both basic scientific and therapeutic relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.