Recombinant Rat Protein FAM151A (Fam151a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per your requirements.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Fam151a; Protein FAM151A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-608
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Fam151a
Target Protein Sequence
MSCKKCCSSSQTKWILAGSVSMTLVLAISMILGLTLYQRTRPGCENDAVCRPDADMLDYL QNIGQISHRDGLLVTWYHAANSKKEMEAALNSDVMVLEADVTVEGFNTANETEVPIMAHP PAIYSDNTLKEWLEAVLASSQKGIKLDFKSLKAVGPSLDLLRQLTEAGRIRRPVWINADI LKGPNVPISTEVNATQFLALVQEKYPKATISPGFTTLYVHQLPNSTYTQAMVETMEELVR ALPQKVTFPMRAVMTRAAWPHFSWLLSQSERYSLTLWQGASDPVSVEDLLFIRDNSAPHQ IYYDLFEPVLSQFKQLALNTTRKRTFYTGGSLIPVLQQPKGDGLEVEWLALEVNDKGRKA AITVPDREGMILLDVGLQEPEVGNPVPVLRTPGGSVLTLESCLLHLAVHATRWSIHVNIT EPAALRPSLATLAHLSTLGHLPWPVWVGATVSYGSFVVPGHIAGRELLTAVAEVFPHVTV APAWPEEMLGSGYQEQMVTEMLELCQGLRQPVSFQLQAGPLGQSPANTVARLLAFSPRAT VTVYHSSAGNSYADVWAGLWAARAVDRTRVYYRIPQEYRKDLLAHVDRHRPSSRTGPSYV EGFPGESR
Uniprot No.

Target Background

Database Links
Protein Families
FAM151 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic molecular structure and cellular localization of Rat FAM151A protein?

FAM151A (Family with Sequence Similarity 151 Member A) is a single-pass membrane protein belonging to the FAM151 family. It is primarily localized in the cellular membrane and has been identified in extracellular exosomes . The protein consists of 585 amino acids and functions as an integral membrane protein . FAM151A exhibits conserved structural domains across species, suggesting evolutionary significance in its functional role. The protein's membrane integration indicates its potential involvement in cellular signaling pathways, membrane transport, or receptor-mediated processes.

For researchers exploring protein structure, it's recommended to employ computational prediction tools in conjunction with experimental approaches such as circular dichroism or X-ray crystallography to elucidate secondary and tertiary structural elements. When studying localization patterns, immunofluorescence microscopy with specific antibodies against FAM151A provides visual confirmation of its membrane association.

What detection methods are available for measuring Rat FAM151A in experimental samples?

The primary method for quantitative detection of Rat FAM151A is sandwich ELISA, which provides precise measurement in various biological samples including serum, plasma, tissue homogenates, and cell culture supernatants . The commercially available Rat FAM151A ELISA kits offer a detection range of 0.156-10ng/mL with a sensitivity threshold of 0.078ng/mL . The assay demonstrates high specificity for both natural and recombinant rat Protein FAM151A.

For experimental design considerations, researchers should note the intra-assay coefficient of variation (CV) of 4.6% and inter-assay CV of 7.6%, which reflects the reliability and reproducibility of the detection method . When analyzing complex biological samples, appropriate sample preparation protocols should be followed to minimize matrix effects and optimize protein recovery.

Alternative detection methods include:

  • Western blotting for semi-quantitative analysis and molecular weight confirmation

  • Immunohistochemistry for tissue-specific localization studies

  • qRT-PCR for mRNA expression level analysis

How does FAM151A expression respond to common environmental toxicants?

FAM151A expression demonstrates significant responsiveness to various environmental toxicants, making it a potential biomarker for toxicological studies. Several well-documented chemical interactions affect FAM151A expression in rat models:

Chemical AgentEffect on FAM151AEvidence TypeNotes
17β-estradiolDecreases expressionISODemonstrated through homology with human FAM151A
2,3,7,8-tetrachlorodibenzodioxineDecreases expressionEXPDirectly observed in experimental studies
3,3',4,4',5-pentachlorobiphenylDecreases expressionEXPConsistently demonstrated across multiple studies
3-chloropropane-1,2-diolIncreases expressionEXPα-Chlorohydrin specifically increases FAM151A mRNA
6-propyl-2-thiouracilDecreases expressionEXPPropylthiouracil treatment results in reduced expression
Aflatoxin B1Decreases expression & increases methylationISOAffects both expression and epigenetic regulation
Benzo[a]pyreneDecreases expressionISOConsistent finding across multiple studies
Bisphenol ABoth decreases and increases expressionEXPDemonstrates context-dependent bidirectional effects

When designing toxicological experiments examining FAM151A responses, researchers should carefully control for exposure time, dose, and cell/tissue type, as these parameters may influence the direction and magnitude of expression changes. Time-course studies are particularly valuable for resolving apparently contradictory results, such as the bidirectional response to Bisphenol A.

What are the predicted functional protein partners of FAM151A and their research implications?

Protein interaction network analysis has identified several predicted functional partners of FAM151A that may provide insights into its biological function. The primary predicted partners include:

  • PLEKHH3 (Pleckstrin homology, MyTH4 and FERM domain containing H3) with an interaction score of 0.466 . This protein contains domains associated with cytoskeletal organization and membrane targeting, suggesting FAM151A may play a role in cellular architecture maintenance.

  • CRB2 (Protein crumbs homolog 2) with an interaction score of 0.461 . CRB2 functions as an apical polarity protein crucial during epithelial-to-mesenchymal transition (EMT) at gastrulation. It promotes cell ingression, defining which cells leave the epithelial epiblast to form new tissue layers. This association suggests FAM151A may participate in developmental processes and tissue organization.

  • FETUB (Fetuin-B) with an interaction score of 0.422 . FETUB acts as a protease inhibitor required for egg fertilization, preventing premature zona pellucida hardening by inhibiting ASTL protease activity. This interaction hints at possible reproductive system functions for FAM151A.

For researchers investigating these interactions, co-immunoprecipitation experiments followed by mass spectrometry analysis would provide empirical verification of these predicted partnerships. Additionally, proximity ligation assays (PLA) could demonstrate in situ interactions within cellular contexts. Understanding these protein-protein interactions may uncover novel functional aspects of FAM151A in cellular signaling pathways and developmental processes.

How can epigenetic regulation of FAM151A be experimentally investigated?

The discovery that aflatoxin B1 increases methylation of the FAM151A gene points to epigenetic regulation as a significant control mechanism. Researchers interested in exploring this aspect should implement a multi-faceted experimental approach:

  • Methylation Analysis:

    • Bisulfite sequencing to map CpG methylation patterns across the FAM151A promoter and gene body

    • Methylation-specific PCR (MSP) for targeted analysis of specific regulatory regions

    • Whole-genome methylation arrays to position FAM151A methylation within broader epigenetic landscapes

  • Chromatin Structure Assessment:

    • Chromatin Immunoprecipitation (ChIP) assays to identify histone modifications associated with FAM151A

    • ATAC-seq to evaluate chromatin accessibility at the FAM151A locus

    • 3D chromatin conformation capture techniques to identify distant regulatory elements

  • Functional Validation:

    • Reporter gene assays with methylated versus unmethylated promoter constructs

    • CRISPR-based epigenetic editing to directly manipulate methylation status

    • Treatment with epigenetic modifiers (DNMTs inhibitors, histone deacetylase inhibitors) to observe expression changes

When investigating the epigenetic regulation after chemical exposure, researchers should design time-course experiments to distinguish between direct and indirect effects. Additionally, comparing tissue-specific epigenetic profiles would help identify context-dependent regulatory mechanisms that may explain differential responses observed in various experimental models.

What experimental approaches would best elucidate the contradictory effects of Bisphenol A on FAM151A expression?

The reported bidirectional effects of Bisphenol A on FAM151A expression—both increases and decreases observed in experimental settings —presents an intriguing research question requiring sophisticated experimental design. To resolve this apparent contradiction, researchers should implement:

  • Dose-Response Relationship Analysis:

    • Systematic evaluation across wide concentration ranges (pM to μM)

    • Identification of potential hormetic effects (biphasic dose responses)

    • Correlation of expression changes with Bisphenol A concentrations in tissues/media

  • Temporal Dynamics Investigation:

    • Time-course experiments ranging from acute (minutes to hours) to chronic exposure (days to weeks)

    • Pulse-chase experiments to evaluate expression recovery kinetics

    • Real-time monitoring using reporter constructs under FAM151A promoter control

  • Context-Dependency Examination:

    • Comparison across different cell types and tissue environments

    • Evaluation in different developmental stages and physiological states

    • Assessment under varying stress conditions or hormonal backgrounds

  • Mechanistic Pathway Analysis:

    • Pharmacological inhibition of candidate signaling pathways

    • siRNA knockdown of potential mediators

    • Phosphoproteomic analysis following Bisphenol A exposure

The experimental design should include appropriate positive controls (known Bisphenol A-responsive genes) and negative controls (genes resistant to Bisphenol A effects). Methodologically, combining RNA-seq for global expression profiling with targeted qRT-PCR validation provides both breadth and precision in measuring FAM151A responses. For protein-level confirmation, western blotting with phospho-specific antibodies can help identify post-translational modifications that might explain seemingly contradictory expression patterns.

How can recombinant FAM151A protein be optimally utilized in in vitro and in vivo studies?

Recombinant FAM151A protein serves as a valuable tool for multiple research applications. For optimal utilization in experimental settings, researchers should consider:

  • In Vitro Applications:

    • Protein-protein interaction studies using pull-down assays or surface plasmon resonance

    • Cell culture supplementation to evaluate exogenous FAM151A effects on cellular functions

    • Antibody validation and standardization for immunoassay development

    • Enzymatic activity assays to identify potential catalytic functions

  • In Vivo Applications:

    • Administration of recombinant protein to animal models to assess systemic effects

    • Local tissue delivery to evaluate tissue-specific responses

    • Pharmacokinetic/pharmacodynamic studies to determine bioavailability and half-life

When working with recombinant FAM151A, protein stability and storage considerations are crucial. The protein should be maintained at -80°C for long-term storage, with aliquoting recommended to avoid freeze-thaw cycles. Prior to experimental use, validation of protein activity and integrity through SDS-PAGE and functional assays ensures experimental reliability. For cellular uptake studies, fluorescently labeled FAM151A conjugates can be employed to track intracellular distribution and trafficking pathways.

What role might FAM151A play in neurodegenerative and cardiovascular disorders?

The implication of FAM151A in neurodegenerative and cardiovascular disorders presents an important research direction. While direct evidence is still emerging, several experimental approaches can help elucidate its role:

  • Expression Analysis in Disease Models:

    • Comparative FAM151A expression profiling in healthy versus diseased tissues

    • Temporal expression changes during disease progression

    • Cell-type specific expression in affected tissues using single-cell RNA sequencing

  • Functional Assessment:

    • Overexpression studies to evaluate protective or detrimental effects

    • CRISPR/Cas9-mediated knockout to assess necessity in disease pathways

    • Dominant-negative mutant expression to interfere with endogenous protein function

  • Mechanistic Investigations:

    • Pathway analysis following FAM151A modulation in disease-relevant cell types

    • Identification of disease-specific protein interactions using BioID or proximity labeling

    • Assessment of FAM151A post-translational modifications in disease states

The predicted interaction with CRB2 , which plays a role in cell polarity and epithelial-to-mesenchymal transition, provides a potential mechanism through which FAM151A might influence vascular remodeling in cardiovascular disorders. Similarly, membrane protein dysfunction is a common theme in neurodegenerative conditions, suggesting FAM151A might participate in neuronal membrane integrity or signaling.

For cardiovascular studies, researchers should employ relevant cell types (cardiomyocytes, endothelial cells, vascular smooth muscle cells) and disease models (ischemia-reperfusion, atherosclerosis). In neurodegenerative research, both in vitro neuronal cultures and in vivo models of conditions like Alzheimer's or Parkinson's disease would be appropriate experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.