Recombinant Rat Protein FAM162A (Fam162a)

Shipped with Ice Packs
In Stock

Description

Introduction

Family with sequence similarity 162, member A (FAM162A), also known as E2IG5, HGTD-P, and C3orf28, is a highly conserved mitochondrial protein found across various species . In humans, FAM162A is encoded by the FAM162A gene . Research indicates that FAM162A plays a crucial role in maintaining mitochondrial structure, dynamics, and bioenergetics, which influences cell viability and stress resistance . Initially identified as a hypoxia-induced pro-apoptotic protein, FAM162A's functions extend beyond apoptosis, with emerging roles in cancer cell proliferation and migration, as well as general mitochondrial regulation and organismal resilience .

Gene and Protein Characteristics

The FAM162A gene, located on chromosome 3 in humans, encodes a protein of 154 amino acids with a calculated molecular weight of approximately 17 kDa . The protein is ubiquitously expressed in many tissues, with higher mRNA expression levels observed in the colon, esophagus, heart, kidney, and liver .

FeatureDescription
Full NameFamily with sequence similarity 162, member A
AliasesE2IG5, HGTD-P, C3orf28
Gene SymbolFAM162A
Gene ID (NCBI)26355
UniProt IDQ96A26 (Human)
Calculated Molecular Weight17 kDa
Observed Molecular Weight17 kDa
Tested ReactivityHuman
Positive WB detected inCaki-2 cells, HepG2 cells, RT-4 cells
Positive IF/ICC detected inA431 cells

Subcellular Localization and Topology

FAM162A primarily resides in the inner mitochondrial membrane (IMM), particularly within the cristae . This localization is crucial for its role in modulating the fusion protein OPA1, which is vital for maintaining mitochondrial dynamics and cristae structure . Earlier predictions suggested the presence of two transmembrane segments, but recent bioinformatic analyses indicate a single transmembrane segment located in the outer mitochondrial membrane (OMM) . This suggests that the N-terminus faces the intermembrane space, while the C-terminus faces the cytosol .

Functional Roles

  1. Mitochondrial Structure and Dynamics: FAM162A is essential for maintaining the ultrastructure of mitochondria and plays a key role in mitochondrial fusion dynamics . Silencing FAM162A leads to smaller, more rounded mitochondria and reduces the levels of OPA1, a protein critical for mitochondrial fusion .

  2. Bioenergetics: FAM162A influences mitochondrial bioenergetics . Knockdown of FAM162A results in bioenergetic deficiencies and affects cell viability .

  3. Stress Resistance and Cell Viability: Overexpression of FAM162A in Drosophila models has demonstrated increased lifespan and enhanced locomotor activity under normal and heat stress conditions, highlighting its protective role against cellular stress .

  4. Apoptosis: FAM162A was initially identified as a hypoxia-induced pro-apoptotic protein . Overexpression of FAM162A sends a signal directly to the mitochondria, leading to cell death . It has been described to participate in hypoxia-induced apoptosis through the binding to the mitochondrial voltage-dependent anion channel (VDAC) to stimulate the opening of the mitochondrial permeability transition pore (mPTP) .

Research Findings

  • Impact on Mitochondrial Morphology: Knockdown of FAM162A results in a significant increase in puncta mitochondria and a decrease in network mitochondria . Mitochondria in FAM162A-depleted cells are smaller and more rounded, with a higher proportion of swollen, apoptotic mitochondria .

  • Interaction with OPA1: FAM162A's localization in the IMM and its influence on OPA1 levels suggest a critical role in maintaining cristae ultrastructure and promoting mitochondrial fusion . Silencing FAM162A leads to a 50% reduction in OPA1 levels .

  • Effects on Organismal Longevity: Overexpression of human FAM162A in transgenic Drosophila extended life expectancy by 25% under normal conditions and 40% under heat stress .

Potential Implications

FAM162A's role in mitochondrial function suggests its involvement in various pathological conditions, including metabolic disorders, neurodegenerative diseases, and cancer . Its ability to protect against cellular stress and extend lifespan in model organisms indicates its potential as a therapeutic target for age-related diseases and other conditions associated with mitochondrial dysfunction .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
Fam162a; E2ig5; Protein FAM162A; E2-induced gene 5 protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MWSLRGLRLAAGHCFRLCERNVSSPLRLTRNTDLKRINGFCTKPQESPKAPTQSYRHRVP LHKPTDFEKKILLWSGRFKKEEEIPETISFEMLDAAKNKIRVKVSYLMIALTVAGCVYMV IEGKKAAKRHESLTSLNLERKARLREEAAMKAKAD
Uniprot No.

Target Background

Function

FAM162A is proposed to regulate apoptosis, though the precise mechanism may vary across cell types and tissues. It may be involved in hypoxia-induced cell death in transformed cells, potentially via cytochrome C release, caspase activation (such as CASP9), and induction of mitochondrial permeability transition. In neuronal cells, FAM162A may also contribute to hypoxia-induced cell death by facilitating AIFM1 release from mitochondria into the cytoplasm and subsequent nuclear translocation. However, the involvement of caspases in this process remains inconsistently reported.

Database Links
Protein Families
UPF0389 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is FAM162A and what are its primary cellular functions?

FAM162A is a mitochondrial protein that is evolutionarily conserved across taxa and ubiquitously expressed in various tissues. It plays a dual role in cellular biology: it is primarily known for its involvement in regulating apoptosis, particularly under hypoxic conditions, but it also has crucial functions in maintaining mitochondrial structure and bioenergetics. The protein contains two transmembrane segments, an extended loop with a short alpha-helix domain, and a C-terminus alpha-helix structure, which contribute to its functional capabilities within the mitochondria. This protein is also referred to by several aliases, including E2-induced gene 5 protein, Growth and transformation-dependent protein, and HIF-1 alpha-responsive proapoptotic molecule.

Where is FAM162A predominantly localized within cells?

FAM162A is primarily localized to the inner mitochondrial membrane, particularly within the cristae structures. This localization has been confirmed through protease protection assays in COS7 cells using GFP-fusion constructs. The precise subcellular localization is crucial for understanding its function, as it positions FAM162A to directly influence mitochondrial dynamics and energy production. Its presence in the cristae specifically allows it to modulate proteins like OPA1, which are essential for maintaining proper mitochondrial fusion and structural integrity.

How evolutionarily conserved is FAM162A across species?

FAM162A demonstrates remarkable evolutionary conservation, with BLAST analysis revealing protein homology ranging from 99% in monkeys to approximately 50% in fish when compared to the human version. This high degree of conservation across diverse taxa strongly suggests that FAM162A performs fundamentally important cellular functions that have been preserved throughout evolution. For researchers working with rat models, it's worth noting that there is significant homology between rat and human FAM162A, making rat models particularly valuable for translational research in this area.

What are the recommended methodologies for studying FAM162A localization in mitochondria?

For precise localization studies of FAM162A within mitochondria, a combination of approaches is recommended:

  • Fluorescence protease protection assay: Create fusion constructs with GFP at either the N-terminus (FAM-N-GFP) or C-terminus (FAM-C-GFP) and express them in an appropriate cell line (e.g., COS7 cells).

  • Co-localization studies: Use established markers for different mitochondrial compartments, such as Omp25_mCherry for the intermembrane space and pmMitoTurquoise for the mitochondrial matrix.

  • Electron microscopy: For ultrastructural localization, immunogold labeling can provide nanometer-scale resolution of FAM162A positioning within mitochondrial subcompartments.

  • Biochemical fractionation: Isolate mitochondria and separate the outer membrane, inner membrane, and matrix fractions using differential centrifugation followed by Western blotting to detect FAM162A.

What experimental design is recommended for investigating FAM162A's role in mitochondrial dynamics?

To investigate FAM162A's role in mitochondrial dynamics, the following experimental approach is recommended:

  • Loss-of-function studies: Implement siRNA knockdown of FAM162A (siFAM162A) in appropriate cell lines.

  • Gain-of-function studies: Create stable cell lines overexpressing FAM162A or use transient transfection approaches.

  • Live-cell imaging: Utilize confocal microscopy with mitochondrial dyes like TMRE or MitoTracker to visualize mitochondrial morphology and dynamics in real-time.

  • Morphological classification: Categorize mitochondria into distinct morphological groups (puncta, large and round, rod, and network) based on established classification systems.

  • Quantitative analysis: Measure parameters including mitochondrial size, perimeter, circularity, and interconnectivity using image analysis software.

  • Protein interaction studies: Investigate FAM162A's interaction with fusion/fission proteins, particularly OPA1, using co-immunoprecipitation or proximity ligation assays.

What methodological approaches can be used to investigate the impact of FAM162A on bioenergetics?

To assess FAM162A's impact on mitochondrial bioenergetics, the following methodological approaches are recommended:

  • Seahorse XF analysis: Measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) in cells with manipulated FAM162A expression to assess respiratory capacity, ATP production, and glycolytic function.

  • ATP production assays: Quantify cellular ATP levels using luminescence-based assays to determine how FAM162A affects energy production.

  • Membrane potential measurements: Use potentiometric dyes like TMRE or JC-1 to assess mitochondrial membrane potential, which is directly linked to bioenergetic function.

  • Electron transport chain complex activity assays: Measure the activity of individual respiratory chain complexes to identify specific points where FAM162A influences electron transport.

  • Metabolic flux analysis: Track the flow of metabolites through key pathways using labeled substrates to determine how FAM162A alters metabolic routing.

How does FAM162A interact with OPA1 to regulate mitochondrial fusion dynamics?

FAM162A has been shown to modulate the fusion protein OPA1, which is critical for mitochondrial inner membrane fusion and cristae organization. To investigate this interaction:

  • Co-immunoprecipitation assays: Pull down FAM162A and probe for OPA1, or vice versa, to confirm physical interaction between these proteins.

  • Proximity ligation assays: Visualize protein interactions in situ within intact cells to determine where in the mitochondria these interactions occur.

  • OPA1 processing analysis: Examine OPA1 isoform patterns in the presence and absence of FAM162A using Western blotting to determine if FAM162A affects OPA1 proteolytic processing.

  • Mitochondrial fusion assays: Utilize photoactivatable GFP or split-GFP approaches to quantify fusion events in cells with modified FAM162A expression.

  • Cristae structure analysis: Employ electron microscopy to assess how FAM162A-OPA1 interactions influence cristae morphology and organization.

Research has shown that FAM162A knockdown results in an increase in punctate mitochondria (from 21% to 34%) and a decrease in network mitochondria (from 26% to 9%), indicating compromised fusion capacity. This phenotype resembles OPA1 dysfunction, supporting a functional relationship between these proteins.

What role does FAM162A play in the paradoxical relationship between apoptosis and cancer cell survival?

FAM162A presents an intriguing paradox: it is known to be pro-apoptotic under hypoxic conditions, yet is overexpressed in various cancers where cell survival is enhanced. To investigate this paradox:

  • Expression analysis in cancer tissues: Compare FAM162A expression levels across normal tissues, hypoxic non-cancerous tissues, and cancer samples using RNA-seq or proteomics approaches.

  • Post-translational modification profiling: Determine if FAM162A undergoes different modifications in cancer versus normal cells, potentially altering its function.

  • Interactome analysis: Identify FAM162A binding partners in cancer versus normal cells using mass spectrometry-based approaches after immunoprecipitation.

  • Functional assays under varying oxygen tensions: Compare FAM162A's effects on apoptosis and mitochondrial function across normoxic, hypoxic, and pseudohypoxic (cancer) conditions.

  • In vivo cancer models: Utilize genetic models with FAM162A manipulation in tumor xenografts to assess its impact on tumor growth, metabolism, and response to therapy.

This research direction could reveal how FAM162A's function is contextually regulated and how cancer cells may co-opt its non-apoptotic functions to promote survival and growth.

How can transgenic animal models be effectively utilized to study FAM162A function at the organismal level?

Transgenic animal models offer valuable insights into FAM162A function at the organismal level. Based on recent research with Drosophila models:

  • Model selection and design:

    • For rapid life cycle studies: Drosophila melanogaster overexpressing human FAM162A

    • For mammalian relevance: Transgenic rat models with FAM162A overexpression or knockout

    • For tissue-specific effects: Conditional expression systems (e.g., Cre-lox in mice)

  • Phenotypic assessment:

    • Lifespan analysis under normal and stress conditions

    • Locomotor activity assays at different ages

    • Metabolic parameters (food intake, body weight, glucose tolerance)

    • Tissue-specific mitochondrial morphology and function

  • Stress resistance testing:

    • Heat stress protocols (as demonstrated in Drosophila studies showing 40% extended lifespan under heat stress)

    • Oxidative stress challenges

    • Hypoxic conditioning

    • Response to mitochondrial toxins

  • Molecular characterization:

    • Tissue-specific proteomic and transcriptomic profiling

    • Mitochondrial DNA copy number and integrity

    • Electron microscopy of tissue mitochondria

    • In vivo metabolic flux analysis

Recent findings with transgenic Drosophila overexpressing human FAM162A showed a remarkable 25% increase in lifespan under normal conditions and 40% increase under heat stress, indicating that FAM162A's protective effects on mitochondria translate to organismal resilience.

How should researchers interpret conflicting data regarding FAM162A's role in caspase activation?

The literature shows conflicting reports regarding FAM162A's involvement in caspase activation during apoptosis. To address and interpret these contradictions:

  • Cell type considerations: Different results may stem from cell-type specific effects. Systematically compare FAM162A's effects across multiple cell types (neuronal, epithelial, transformed, primary) to establish context-dependent patterns.

  • Stimulus-specific responses: Separately analyze FAM162A's role following different apoptotic stimuli (hypoxia, oxidative stress, death receptor activation) as the protein may have stimulus-specific functions.

  • Temporal dynamics: Perform time-course experiments as caspase involvement may vary during different phases of the apoptotic response.

  • Parallel pathways assessment: Simultaneously measure both caspase-dependent and caspase-independent pathways (such as AIFM1 translocation) to determine if FAM162A differentially regulates these parallel death mechanisms.

  • Quantitative approach: Use dose-response relationships and quantitative measures of activation rather than binary (yes/no) assessments of caspase involvement.

The conflicting reports regarding caspase involvement likely reflect the complex, context-dependent nature of FAM162A function, where it may promote AIFM1-mediated cell death in neuronal cells while activating caspases in transformed cells.

What methods can be used to distinguish between FAM162A's direct effects on mitochondria versus secondary consequences?

Distinguishing direct from indirect effects of FAM162A on mitochondrial function requires careful experimental design:

  • Acute versus chronic manipulation: Compare immediate effects of FAM162A addition (using recombinant protein delivery or rapid induction systems) with long-term expression changes to separate primary from adaptive responses.

  • In vitro reconstitution: Use purified components and isolated mitochondria to test if FAM162A directly affects specific mitochondrial processes in a cell-free system.

  • Structure-function analysis: Create FAM162A mutants with altered domains to identify which regions are required for specific mitochondrial effects.

  • Temporal sequence analysis: Establish the precise timeline of events following FAM162A manipulation, using high-resolution time-lapse imaging or time-course biochemical assays.

  • Rescue experiments: Determine if mitochondrial phenotypes can be rescued by targeting downstream effectors without restoring FAM162A expression.

  • Quantitative correlation analysis: Assess whether the degree of mitochondrial changes correlates directly with FAM162A expression levels across different experimental conditions.

What are the critical controls needed when studying FAM162A in rat models versus other species?

When studying FAM162A in rat models compared to other species, the following critical controls should be implemented:

Given the high evolutionary conservation of FAM162A (88% sequence identity between rat and mouse orthologs), rat models provide valuable translational insights, but these controls ensure proper interpretation of cross-species comparisons.

How can recombinant FAM162A be optimally prepared and stored for functional studies?

Based on protocols for similar recombinant mitochondrial proteins, the following recommendations apply for FAM162A:

  • Expression system selection:

    • E. coli-based expression systems are suitable for producing the soluble domains of FAM162A

    • For full-length protein with proper folding of transmembrane domains, consider insect cell or mammalian expression systems

  • Purification strategy:

    • Use affinity tags (His, GST) positioned to avoid interference with functional domains

    • Include detergent screening to identify optimal conditions for maintaining native structure of transmembrane regions

    • Consider on-column refolding protocols if inclusion bodies form during expression

  • Storage conditions:

    • Store lyophilized protein with appropriate stabilizers like trehalose

    • For solution storage, maintain in buffers containing 10-20% glycerol at -80°C

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

  • Quality control assessments:

    • Verify proper folding using circular dichroism spectroscopy

    • Confirm activity through functional assays (e.g., binding to known interaction partners)

    • Monitor batch-to-batch consistency with standardized assays

These recommendations are based on protocols for similar recombinant proteins with mitochondrial transmembrane domains.

What innovative approaches could advance our understanding of FAM162A's role in neurodegeneration?

Given FAM162A's role in mitochondrial health and its involvement in neuronal cell death pathways, several innovative approaches could illuminate its contribution to neurodegeneration:

  • Patient-derived models:

    • Generate induced pluripotent stem cells (iPSCs) from patients with neurodegenerative disorders

    • Differentiate these into neurons and assess FAM162A expression, localization, and function

    • Use CRISPR-Cas9 to modify FAM162A levels in these models and observe effects on disease phenotypes

  • Advanced imaging approaches:

    • Implement super-resolution microscopy to visualize FAM162A's precise distribution within mitochondrial subcompartments

    • Develop FAM162A biosensors to monitor its activation or conformational changes in live neurons

    • Use correlative light and electron microscopy to link functional changes with ultrastructural alterations

  • In vivo neural circuit assessment:

    • Develop transgenic rat models with conditional FAM162A manipulation in specific neural circuits

    • Implement electrophysiological recording to assess how FAM162A affects synaptic transmission and network activity

    • Use in vivo calcium imaging to monitor neural activity patterns

  • Systems biology integration:

    • Apply multi-omics approaches (transcriptomics, proteomics, metabolomics) to identify FAM162A-dependent signatures in neurodegeneration

    • Develop computational models that integrate FAM162A's dual roles in apoptosis and mitochondrial function

These approaches could clarify whether FAM162A represents a potential therapeutic target for neurodegenerative conditions characterized by mitochondrial dysfunction and neuronal cell death.

How might the relationship between FAM162A and OPA1 inform therapeutic strategies for mitochondrial diseases?

The functional relationship between FAM162A and OPA1 opens several promising therapeutic avenues for mitochondrial diseases:

  • Targeted approach for optic neuropathies:

    • Since OPA1 mutations cause dominant optic atrophy, modulating FAM162A could potentially compensate for OPA1 dysfunction

    • Develop small molecules that strengthen the remaining FAM162A-OPA1 interaction in patients with OPA1 mutations

    • Create peptide mimetics of the FAM162A-OPA1 interaction interface to restore proper cristae structure

  • Mitochondrial fusion enhancement strategies:

    • Screen for compounds that enhance FAM162A activity to promote mitochondrial network formation in diseases characterized by fragmented mitochondria

    • Develop gene therapy approaches to increase FAM162A expression in affected tissues

  • Stress resistance augmentation:

    • Given FAM162A's role in extending lifespan under stress conditions, develop interventions that upregulate FAM162A in tissues vulnerable to metabolic or oxidative stress

    • Create combination therapies targeting both FAM162A and metabolic pathways to enhance mitochondrial resilience

  • Biomarker development:

    • Establish FAM162A expression or post-translational modification patterns as biomarkers for mitochondrial disease progression

    • Use the FAM162A-OPA1 interaction strength as a functional readout of mitochondrial health

The protective effects demonstrated in the Drosophila model, where FAM162A overexpression extended lifespan and improved stress resistance, suggest that enhancing this protein's function could have broad therapeutic potential across conditions involving mitochondrial dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.