Recombinant Rat Protein FAM210A (Fam210a)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Rat Protein FAM210A (Fam210a), also known as family with sequence similarity 210 member A, is a protein that has been identified as playing a crucial role in various biological processes, including maintaining skeletal muscle structure and strength, modulating mitochondrial function, and influencing cardiac remodeling . Research indicates its involvement in bone and muscle structure, energy production, and intracellular signaling .

Gene Information

CategoryInformation
Gene NameFam210a family with sequence similarity 210, member A $$Rattus norvegicus]
Official SymbolFAM210A
Gene ID307343
mRNA RefseqNM_001007688.3
Protein RefseqNP_001007689.1
UniProt IDQ5XIJ4
SourceMammalian Cells
TagHis
Purity>80%
Endotoxin< 1.0 EU per μg of the protein as determined by the LAL method.
StorageStore at +4 ºC for short term. For long term storage, store at -20 ºC~-80 ºC.
Storage BufferPBS buffer

Function and Significance

  1. Muscle Maintenance: FAM210A is essential for maintaining skeletal muscle structure and strength . Studies in mice have shown that FAM210A expression is positively associated with muscle mass, and its deletion leads to muscle atrophy and weakness .

  2. Cardiac Remodeling: FAM210A is regulated by microRNA-574 (miR-574) and modulates mitochondrial-encoded protein expression, which influences cardiac remodeling in heart failure .

  3. Mitochondrial Function: FAM210A functions as a novel regulatory factor of mitochondrial-encoded protein expression . It maintains mitochondrial homeostasis by regulating the translation of mitochondria-encoded mRNAs .

  4. Bone Structure: Genetic variation near the FAM210A gene is associated with bone structure . Studies have found that reduced FAM210A expression leads to decreased bone formation and increased bone resorption .

  5. Protein Synthesis: FAM210A mediates an inter-organelle crosstalk essential for protein synthesis and muscle growth. It regulates cytosolic protein translation in skeletal muscle cells .

Research Findings

  • MicroRNA Regulation: MicroRNA-574 (miR-574) regulates FAM210A expression. Both miR-574-5p and miR-574-3p target FAM210A to modulate the expression of mitochondrial-encoded ETC proteins .

  • Cardiac Studies: Studies using miR-574 null mice showed severe cardiac dysfunction under stress conditions. Exogenous delivery of miR-574 mimics protected against pathogenesis .

  • Muscle Studies: Muscle-specific knockout of Fam210a in mice reduces mitochondrial density and function, leading to progressive muscle atrophy and premature death .

  • Metabolic Impact: Loss of FAM210A in skeletal muscle causes systemic metabolic dysfunction, including abnormal flow of the TCA cycle and accumulation of acetyl-CoA, leading to hyperacetylation of ribosomal proteins and translational defects .

  • Clinical Correlation: FAM210A protein levels were found to be lower in the soleus muscle of mdx mice, a model of human Duchenne Muscular Dystrophy (DMD). Conversely, elevated expression of Fam210a mRNA was detected in hypertrophic muscles .

  • Polysome Profiling and AHA Labeling Assays: FAM210A regulates MEG protein expression based on polysome profiling and AHA labeling assays .

  • Ischemic Stress Protection: Overexpression of FAM210A protects the hearts from cardiac injury and pathological remodeling in a mouse MI model .

FAM210A and Bone Metabolism

ParameterCt Mouse BonesFam210a Mouse Bones
Mineral Apposition Rate (MAR)NormalSignificantly Lower
Bone Formation Rate (BFR)NormalSignificantly Lower
Osteoclast Number (Oc.N/BS)NormalSignificantly Higher
Osteoclast Surface (Oc.S/BS)NormalSignificantly Higher
Grip StrengthNormalSignificantly Lower
Lean MassNormalSignificantly Lower

Potential Therapeutic Applications

Given its role in muscle maintenance, cardiac function, and bone structure, Recombinant Rat Protein FAM210A (Fam210a) represents a potential therapeutic target for:

  • Muscle-related disorders: such as sarcopenia and muscular dystrophy

  • Cardiac diseases: including heart failure and cardiac remodeling

  • Bone-related conditions: such as osteoporosis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Fam210a; Protein FAM210A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Fam210a
Target Protein Sequence
MQWNVPRTMSRLALRTFLEAQKARLFDHHRSTKGLLLVHRGEYRVAWTPHLRKQWLHLSA VQCLAKQRNLLDAQPPQRGALPQGRWEQDILSKRVLSSSSTSQETPSEKKEEPDPLQDKS ISLYQRFKKTFRQYGKVLIPVHLITSGIWFGTFYYASIKGVNVIPFLEFLGLPDSVVDIL KNSQSGNALTAYAMFKIATPARYTVTLGGTSFTVKYLRSHGYMSTPPPVKEYLQGRMEET KELISEKMEETKDRLTEKLQETKEKVSFKKKVE
Uniprot No.

Target Background

Function
Plays a potential role in the structural integrity and strength of both muscle and bone tissue.
Database Links

KEGG: rno:307343

UniGene: Rn.8288

Protein Families
FAM210 family
Subcellular Location
Membrane; Single-pass membrane protein. Mitochondrion. Cytoplasm.

Q&A

What is FAM210A and where is it primarily expressed?

FAM210A (Family With Sequence Similarity 210 Member A) is a mitochondrial protein with high conservation across 213 organisms including humans, mice, rats and other vertebrates. It is primarily expressed in skeletal muscle, heart, and brain tissues . Within cells, the majority of FAM210A localizes to mitoplasts (mitochondrial inner membrane and matrix), with a smaller fraction at the mitochondrial outer membrane . Importantly, while FAM210A strongly influences bone structure and strength, histochemical analysis using X-Gal staining in Fam210a heterozygous global knockout mice shows no expression in bone tissue itself .

What are the primary cellular functions of FAM210A?

FAM210A plays a critical role in regulating mitochondrial encoded protein (MEG) expression. It functions in the mitochondrial translation machinery by interacting with multiple proteins, particularly ATAD3A and mitochondrial elongation factor EF-Tu (TUFM) . Through these interactions, FAM210A modulates the translation efficiency of mitochondrial-encoded genes at the elongation step. Pulse-chase AHA labeling assays demonstrate that overexpression of FAM210A increases translation of multiple MEG proteins, including several mitochondrial-encoded electron transport chain (ETC) complex components from Complexes I, III, IV, and V . FAM210A appears to coordinate the expression balance between mitochondrial-encoded genes (MEG) and nuclear-encoded mitochondrial genes (NEMG) proteins in cardiomyocytes and other cells .

How does FAM210A affect muscle tissue?

FAM210A expression is positively associated with muscle mass in mice. Deletion of Fam210a using Myl1-driven Cre recombinase in muscle cells leads to progressive myopathy and severe muscle weakness in mice, resulting in systemic metabolic defects and premature death . At the cellular level, loss of Fam210a disrupts mitochondrial cristae structure and reduces mitochondrial abundance in myofibers, accompanied by deficiencies in mitochondrial energy metabolism . Parameters of muscle function and structure, including grip strength and lean mass of all limbs, are decreased in Fam210a knockout mice .

How is FAM210A expression regulated?

FAM210A is regulated by microRNA-574, with both miR-574-5p and miR-574-3p targeting the Fam210a transcript. Upon cardiac stress, such as thoracic aortic constriction (TAC), miR-574-5p is induced, likely as a protective mechanism to restrict FAM210A expression . In wild-type mice, FAM210A protein levels remain relatively stable at early stages of TAC (days 3 and 7) but become significantly induced at later stages (days 14 and 21) . In miR-574-null mice, FAM210A protein is significantly induced at an earlier stage following TAC, indicating that miR-574 normally acts as a molecular brake on FAM210A expression . Additional experiments confirmed that miR-574-3p target sites in the Fam210a 3'UTR are functional through luciferase reporter assays .

What molecular pathways does FAM210A influence in mitochondria?

FAM210A affects mitochondrial function through multiple mechanisms:

  • Mitochondrial translation: FAM210A interacts with EF-Tu and ATAD3A to increase translation efficiency in mitochondria at the elongation step. Polysome profiling shows that mRNAs of ND3, CYTB, CO1, and ATP6 are more enriched in large mitoribosome subunits and heavy polysome fractions when FAM210A is overexpressed .

  • TCA cycle regulation: Loss of Fam210a reverses the oxidative TCA cycle towards the reductive direction, resulting in acetyl-CoA accumulation .

  • Protein acetylation: The acetyl-CoA accumulation leads to hyperacetylation of cytosolic proteins, particularly ribosomal proteins, causing ribosome disassembly and translational defects .

  • Inter-organelle crosstalk: FAM210A mediates critical communication between mitochondria and ribosomes, as demonstrated by the finding that transplantation of Fam210a-knockout mitochondria into wildtype myoblasts is sufficient to elevate protein acetylation in recipient cells .

What experimental models are available for studying FAM210A function?

Several genetically modified mouse models have been developed to study FAM210A:

  • Global knockout model: Fam210a heterozygous and homozygous knockout mice (Fam210a+/- and Fam210a-/-) have been generated to study systemic effects of Fam210a deletion .

  • Muscle-specific knockout model: Myl1-driven Cre Fam210a knockout mice (Fam210a MKO) have been created to study muscle-specific effects. These mice exhibit progressive muscle atrophy and premature death .

  • Reporter systems: Fam210a heterozygous global knockout mice expressing a lacZ reporter under the control of the Fam210a promoter have been used to study tissue expression patterns through X-Gal staining .

These models have revealed that FAM210A strongly influences the structure and strength of both muscle and bone, despite being expressed in muscle but not in bone, suggesting an indirect mechanism of action on bone tissue .

What techniques can be used to assess FAM210A's role in mitochondrial translation?

To assess FAM210A's role in mitochondrial translation, researchers can employ:

  • Polysome profiling: This technique separates ribosomes based on their sedimentation properties, allowing analysis of the association between specific mRNAs and ribosomes. For FAM210A studies, polysome profiling of mitochondrial fractions from cells overexpressing FAM210A (with mock transfection as control) can reveal enrichment of mitochondrial-encoded mRNAs in large mitoribosome subunits and heavy polysome fractions .

  • AHA labeling assay: This pulse-chase method uses azidohomoalanine (AHA), a methionine analog, to label newly synthesized proteins. For FAM210A research, short time pulse-chase AHA labeling can demonstrate that overexpression of FAM210A increases translation of multiple mitochondrial-encoded proteins .

  • Immunoprecipitation-mass spectrometry: Using a FAM210A-specific antibody to pull down endogenous FAM210A from purified mitochondria, followed by mass spectrometry analysis, reveals its interactome including translation machinery proteins like EF-Tu and ATAD3A .

How does FAM210A contribute to cardiac pathology?

In the context of cardiac stress and tissue injury, FAM210A appears to exacerbate pathological remodeling responses by over-activating mitochondrial protein expression and altering the balance between cytoplasmic and mitochondrial electron transport chain component proteins . This imbalance may promote heart failure progression. Experiments in mouse models show that:

  • FAM210A protein expression is induced in hearts of wild-type mice upon isoproterenol (ISO) treatment, with significantly higher levels in miR-574-/- mice .

  • Thoracic aortic constriction (TAC) surgery leads to increased reactive oxygen species (ROS) production in the hearts of miR-574-/- mice compared to wild-type mice, correlating with higher FAM210A levels .

  • Nanoparticle delivery of miR-574-5p and miR-574-3p mimics reduces FAM210A protein expression in therapeutic mouse models, accompanied by decreased ROS production and restored ATP production compared to control miRNA mimics injection in mice under TAC surgery .

These findings suggest that FAM210A plays a potentially pathogenic role in cardiac remodeling, with miR-574 serving as a protective regulator.

What is the relationship between FAM210A and human musculoskeletal conditions?

Genetic variation near FAM210A has been strongly associated with both appendicular and whole body lean mass, as well as bone mineral density in humans . This makes FAM210A a potential therapeutic target for age-related musculoskeletal conditions like osteoporosis and sarcopenia. In genetically modified mouse models, Fam210a strongly influences the structure and strength of both muscle and bone .

The dual effect on both tissues is particularly interesting because Fam210a is expressed in muscle but not in bone, suggesting an indirect mechanism whereby muscle-expressed Fam210a affects bone structure and strength. This presents a novel pathway that may lead to the development of new treatments for both osteoporosis and sarcopenia .

What controls should be included when designing FAM210A knockout experiments?

When designing FAM210A knockout experiments, the following controls should be included:

  • Wild-type controls: Use littermate wild-type mice (Fam210a+/+) as primary controls to minimize genetic background differences.

  • Cre-only controls: For tissue-specific knockouts using Cre-loxP systems (e.g., Myl1-Cre for muscle-specific deletion), include Cre-positive but flox-negative mice to control for potential Cre toxicity or off-target effects.

  • Heterozygous models: Include Fam210a+/- mice to examine potential gene dosage effects, as seen in studies showing intermediate phenotypes in heterozygous knockout mice .

  • Age-matched controls: As Fam210a knockout leads to progressive myopathy, age-matching is essential to accurately assess phenotypic changes over time.

  • Tissue specificity verification: Confirm the tissue-specific deletion through methods like X-Gal staining in reporter models or quantitative RT-PCR of target tissues, as demonstrated in studies verifying Fam210a expression in muscle but not bone .

How can researchers resolve contradictory data in FAM210A studies?

Researchers may encounter contradictory data when studying FAM210A due to its complex roles in multiple tissues and cellular compartments. To resolve such contradictions:

  • Consider tissue specificity: FAM210A functions may differ between tissues. While expressed in muscle, heart, and brain, its absence in bone tissue despite effects on bone structure suggests tissue-specific mechanisms .

  • Examine temporal dynamics: FAM210A's effects may be time-dependent. For example, in wild-type mice under TAC, FAM210A protein levels remain stable early (days 3-7) but increase significantly later (days 14-21) .

  • Analyze subcellular localization: FAM210A localizes primarily to mitoplasts with a smaller fraction at the mitochondrial outer membrane. Subcellular fractionation experiments should be performed to determine if contradictory results stem from different subcellular pools .

  • Consider interacting partners: FAM210A interacts with multiple proteins including ATAD3A and EF-Tu. Different experimental conditions may affect these interactions, leading to variable results .

  • Examine microRNA regulation: Both strands of miR-574 regulate FAM210A. Variations in miR-574 expression across experimental models could explain discrepancies in FAM210A levels and function .

What are the best methods for detecting and quantifying FAM210A protein?

For optimal detection and quantification of FAM210A protein:

  • Western blotting: Use FAM210A-specific antibodies validated against knockout controls. Subcellular fractionation should be performed to separate mitochondrial fractions where FAM210A is primarily localized .

  • Immunofluorescence: This technique can visualize the subcellular localization of FAM210A, which has been shown to be present in mitochondria and cytoplasm of muscle cells and myotubes .

  • Mass spectrometry: This approach can be used for absolute quantification of FAM210A protein levels and to identify post-translational modifications that may affect function.

  • Reporter systems: X-Gal staining in mice expressing lacZ under the Fam210a promoter provides tissue-specific expression patterns, as demonstrated in studies showing expression in skeletal muscle, heart, and brain but not in bone .

When analyzing FAM210A levels, it's important to note that it is not detectable in serum, indicating it may not be a secreted protein under normal conditions (though it might be released from severely damaged muscle) .

How should researchers analyze the impact of FAM210A on mitochondrial function?

To comprehensively analyze FAM210A's impact on mitochondrial function:

  • Respiratory analysis: Measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) using platforms like Seahorse XF Analyzer to assess mitochondrial respiration in cells with modified FAM210A expression.

  • Mitochondrial morphology: Examine mitochondrial cristae structure using electron microscopy, as loss of Fam210a has been shown to disrupt cristae structure .

  • Mitochondrial abundance: Quantify mitochondrial content using mitochondrial DNA copy number, MitoTracker staining, or immunofluorescence for mitochondrial markers.

  • TCA cycle analysis: Perform metabolomic analysis focusing on TCA cycle intermediates, as Fam210a knockout reverses the oxidative TCA cycle towards the reductive direction .

  • Protein acetylation assessment: Measure acetylation levels of cytosolic proteins, especially ribosomal proteins, which become hyperacetylated due to acetyl-CoA accumulation in Fam210a knockout models .

  • Mitochondrial translation: Use techniques like polysome profiling of mitochondrial fractions and AHA labeling assays to assess translation of mitochondrial-encoded proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.