Recombinant Rat Protein FAM26E (Fam26e)

Shipped with Ice Packs
In Stock

Description

Biological Functions

FAM26E is a pore-forming subunit of voltage-gated calcium channels and participates in cellular processes such as:

  • Calcium Homeostasis: Regulates intracellular calcium flux, impacting cell survival and apoptosis .

  • Immune Modulation: Enhances antigen presentation and macrophage activation via calcium signaling pathways .

  • Structural Role: Forms hexameric ion channels critical for membrane potential maintenance .

In Vitro Studies

  • Used in ELISA, SDS-PAGE, and functional assays to study calcium-dependent signaling .

  • Demonstrated utility in blocking experiments for antibody validation (e.g., PA5-65133) .

Pathway Analysis

FAM26E interacts with proteins involved in cation channel activity, including TRPM1 and ASIC3 . Key pathways include:

PathwayRelated Proteins
Calcium signalingCALHM2, CALHM3, P2RX1
Immune response regulationIRF1, STAT1, JAK2

Key Research Findings

  • Structural Insights: The N-terminal domain (aa 1–80) is essential for hexameric channel assembly .

  • Functional Mutations: Residues E171 and R197 are critical for calcium flux modulation .

  • Disease Associations: Dysregulation linked to autoimmune disorders and impaired hematopoietic stem cell differentiation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Calhm5; Fam26e; Calcium homeostasis modulator protein 5; Protein FAM26E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Calhm5
Target Protein Sequence
MDAFQSILKFFLNQKTAIGYSFMALLTVGSERLFSLVAFKCPCSIENTAYGLVFLFAPAW VLLILGFFLNNKAWRLFTGCCMNPQKIFPRRRCCRFFYVLGHITLSSLVAPVMWLSVALL NGTFYECAMSGTRSTRLLEMICKGKPKECWEELHKVSCGKSSMAAMDSEEVRLSLQAQSQ ILGWCLICSASFFSLLTTCYARCRSKVSYLQLSFWKTYAQREKEQLENKLLEYANKLSER NLKCFFENKKPDPFPMPSFAAWEAASELHSFHQDREHYSTLHKVVDDGLEQTPQEEETTM ILVGTAQSL
Uniprot No.

Target Background

Function
Pore-forming subunit of a voltage-gated ion channel.
Database Links

KEGG: rno:294431

UniGene: Rn.104918

Protein Families
CALHM family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FAM26E and how does it relate to other FAM26 family members?

FAM26E is a member of the FAM26 gene family, which includes several paralogs such as FAM26F (also known as INAM). The FAM26 family consists of membrane proteins that share structural similarities and potentially related functions in cellular signaling. Based on sequence alignment studies, FAM26 family members typically share 60-75% amino acid identity between species orthologs, similar to the 71.7% identity observed between mouse and human INAM/FAM26F . The specific functions of FAM26E are still being characterized, but its relationship to FAM26F suggests potential roles in immune response pathways.

What are the structural characteristics of Recombinant Rat FAM26E protein?

Recombinant Rat FAM26E, like other members of the FAM26 family, is characterized as a transmembrane protein. While specific structural data for FAM26E is limited, based on similar recombinant rat proteins, it likely contains:

  • A predicted cytoplasmic domain

  • A transmembrane region

  • An extracellular domain with potential glycosylation sites

When expressed recombinantly, these proteins are typically produced with tags (such as 6-His) for purification purposes, similar to other recombinant rat proteins like TRANCE/RANK L/TNFSF11 which contains an N-terminal 6-His tag .

What expression systems are optimal for producing Recombinant Rat FAM26E?

For membrane proteins like FAM26E, mammalian expression systems generally provide the best results for proper folding and post-translational modifications. Based on methodologies used for similar rat recombinant proteins:

  • Cell Line Selection: HEK293 or CHO cells typically yield properly folded membrane proteins with correct glycosylation patterns.

  • Expression Vector: Vectors containing strong promoters (CMV) and appropriate secretion signals.

  • Induction Conditions: For inducible systems, optimize temperature (typically 30-37°C) and induction duration (24-72 hours).

  • Harvest Timing: Determine optimal harvest time through small-scale time-course experiments to maximize yield while minimizing degradation.

What purification strategies are most effective for Recombinant Rat FAM26E?

Purification of membrane proteins like FAM26E requires specialized approaches:

  • Solubilization: Use appropriate detergents (CHAPS, DDM, or Triton X-100) to solubilize membrane fractions.

  • Affinity Chromatography: If expressed with tags (e.g., 6-His), use nickel affinity columns for initial purification.

  • Size Exclusion Chromatography: Further purify using gel filtration to separate monomeric protein from aggregates.

  • Buffer Optimization: Final product is typically formulated in a stabilizing buffer containing appropriate salt concentrations (e.g., NaCl), buffer components (e.g., sodium phosphate, MES), and potentially calcium (CaCl₂) .

The purified protein can then be supplied as either a solution or in lyophilized form depending on downstream applications.

What are the optimal storage conditions for Recombinant Rat FAM26E?

Based on storage recommendations for similar recombinant rat proteins:

Storage FormTemperatureDurationAdditivesNotes
Lyophilized-20°C to -80°CUp to 1 yearNoneProtect from moisture
Reconstituted-80°CUp to 3 months10-50% glycerolStore in small aliquots
Working solution4°C1-2 weeks0.1% BSAFor immediate use

It's recommended to use a manual defrost freezer and avoid repeated freeze-thaw cycles to maintain protein integrity . Reconstitution should be performed according to specific protein requirements, typically at concentrations around 100 μg/mL in an appropriate buffer.

How can I assess the stability and activity of stored FAM26E samples?

To assess protein stability:

  • SDS-PAGE Analysis: Run samples on reducing and non-reducing gels to check for degradation or aggregation.

  • Western Blot: Use specific antibodies to confirm identity and integrity.

  • Size Exclusion Chromatography: Monitor for changes in elution profile that might indicate aggregation.

  • Functional Assays: Develop and validate functional assays specific to FAM26E to confirm activity retention after storage.

How can I design optimal experiments to study FAM26E function in immune response pathways?

Designing robust experiments for FAM26E functional studies requires careful consideration:

  • Cell Models: Select appropriate cell lines expressing relevant interacting partners or reporter systems.

  • Stimulation Conditions: Based on the relationship with INAM/FAM26F, consider polyI:C stimulation which has been shown to induce related family members .

  • Readout Systems: Incorporate multiple readout methods:

    • Protein-protein interaction assays (co-IP, FRET)

    • Signaling pathway activation markers

    • Transcriptional reporters for downstream effects

  • Controls: Include both positive controls (known pathway activators) and negative controls (inactive protein variants).

For experimental design optimization, consider implementing machine learning approaches similar to those used for optimizing material science experiments. These methods can help maximize information gain while minimizing resource expenditure .

What methodologies are effective for studying FAM26E protein-protein interactions?

To study protein-protein interactions involving FAM26E:

  • Co-immunoprecipitation: Use tagged versions of FAM26E to pull down interaction partners.

  • Proximity Labeling: Employ BioID or APEX2 fusions to identify proximal proteins in living cells.

  • Crosslinking Mass Spectrometry: Apply chemical crosslinkers followed by MS analysis to identify interaction interfaces.

  • Membrane Yeast Two-Hybrid: Consider specialized Y2H systems designed for membrane proteins.

  • Surface Plasmon Resonance: For quantitative binding kinetics of purified components.

How can I improve low expression yields of Recombinant Rat FAM26E?

Low expression yields are common with membrane proteins. Consider these optimization approaches:

  • Codon Optimization: Adjust codons for optimal expression in your chosen system.

  • Expression Tags: Test different tag positions (N-terminal vs. C-terminal) for improved expression.

  • Cell Line Screening: Compare expression in multiple cell lines (HEK293, CHO, SF9).

  • Temperature Modulation: Lower cultivation temperature (28-30°C) can improve folding.

  • Additives: Include chemical chaperones like DMSO (0.5-2%) or glycerol (5-10%) in culture media.

  • Expression Constructs: Consider expressing only the extracellular domain for easier production.

What strategies can address protein aggregation issues during FAM26E purification?

Membrane protein aggregation is a common challenge that can be addressed through:

  • Detergent Screening: Systematically test different detergents (DDM, CHAPS, digitonin) at various concentrations.

  • Buffer Optimization: Adjust pH, salt concentration, and consider additives like glycerol or specific lipids.

  • Purification Temperature: Perform all steps at 4°C to minimize aggregation.

  • Stabilizing Additives: Include specific ions that might be required for structural stability (e.g., calcium ions as seen with MMP-8 ).

  • Fusion Partners: Consider solubility-enhancing fusion partners like MBP or SUMO.

How can I design experiments to identify the signaling pathways affected by FAM26E?

To elucidate signaling pathways:

  • Phosphoproteomics: Compare phosphorylation patterns in cells with and without FAM26E expression.

  • CRISPR Knockout/Knockin: Generate FAM26E knockout cell lines to study loss-of-function effects.

  • Signaling Inhibitors: Use specific pathway inhibitors to identify which signaling cascades are involved.

  • Transcriptomics: Perform RNA-seq to identify genes whose expression changes with FAM26E activity.

  • Conditional Expression Systems: Develop inducible systems to study acute vs. chronic effects.

Information-theoretic approaches as described in optimal experimental design literature can help maximize the information gained from these complex experiments .

What are the methodological considerations for studying FAM26E in comparison to other FAM26 family members?

When conducting comparative studies:

  • Sequence Alignment Analysis: Perform detailed alignments to identify conserved domains across family members, similar to the mouse-human comparison approach used for INAM .

  • Parallel Expression Systems: Express multiple family members under identical conditions for direct comparison.

  • Domain Swap Experiments: Create chimeric proteins to identify functional domains.

  • Cross-Species Comparisons: Compare rat FAM26E with orthologs from other species to identify evolutionarily conserved functions.

  • Tissue Expression Profiling: Map expression patterns of different family members across tissues to identify unique vs. overlapping expression domains.

How should I validate antibodies for detecting endogenous vs. recombinant FAM26E?

Rigorous antibody validation is essential:

  • Western Blot Analysis:

    • Test in multiple cell lines with known FAM26E expression levels

    • Include positive controls (recombinant protein) and negative controls (knockout cells)

    • Examine band pattern in reducing vs. non-reducing conditions

  • Immunoprecipitation Efficiency:

    • Determine recovery percentage of known quantities of recombinant protein

    • Confirm specificity by mass spectrometry of immunoprecipitated material

  • Cross-Reactivity Assessment:

    • Test against related family members (especially FAM26F/INAM)

    • Evaluate specificity across species if conducting comparative studies

  • Epitope Mapping:

    • Identify the specific region recognized by the antibody

    • Consider how protein modifications might affect antibody binding

What statistical approaches are most appropriate for analyzing FAM26E functional data?

For robust statistical analysis:

  • Sample Size Determination:

    • Conduct power analysis based on expected effect sizes

    • Consider biological replicates (different cell preparations) vs. technical replicates

  • Normalization Methods:

    • Select appropriate housekeeping controls for expression studies

    • Consider global normalization methods for high-throughput data

  • Statistical Tests:

    • For normally distributed data: t-tests, ANOVA with appropriate post-hoc tests

    • For non-parametric data: Mann-Whitney, Kruskal-Wallis tests

    • For complex designs: consider mixed-effects models

  • Machine Learning Approaches:

    • Consider implementing neural network surrogate models for complex datasets

    • These can help identify patterns in multidimensional data that may not be apparent with standard statistical tests

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.