Recombinant Rat Protein FAM26F (Fam26f)

Shipped with Ice Packs
In Stock

Description

Key Biological Functions

  • Immune Cell Communication: Facilitates homophilic interactions between immune cells (CD4⁺, CD8⁺, NK cells, dendritic cells) to coordinate responses .

  • Antiviral and Antitumor Activity: Synergizes with myeloid dendritic cells to activate NK cells against tumors via its cytoplasmic tail .

  • Calcium Homeostasis: Interacts with calcium-regulating proteins (e.g., Calpain, Calmodulin) to modulate intracellular signaling .

Interacting Partners

Recombinant FAM26F interacts with proteins involved in calcium signaling and innate immunity:

ProteinFunctionLocalization
ThioredoxinRedox regulation, immune response modulationCytoplasm, nucleus
CalpainCalcium-dependent proteolysisCytoplasm, plasma membrane
VinculinCytoskeletal remodeling, adhesionPlasma membrane, cytoskeleton
Peroxiredoxin-2Antioxidant defense, calcium transportCytoplasm

These interactions suggest FAM26F’s role in linking calcium dynamics to immune activation .

Infection and Disease Models

  • HBV Infection: FAM26F expression is downregulated in HBV-infected cells and individuals, but upregulated by antioxidants (e.g., NAC) and calcium inhibitors (e.g., BAPTA-AM) .

  • Viral Load Prognosis: Pre-infection FAM26F levels in SIV-infected macaques inversely correlate with viral load, highlighting its potential as an early biomarker .

Cancer and Transplantation

  • Tumor Microenvironment: Synergistic expression on NK cells and dendritic cells enhances antitumor immunity, positioning FAM26F as a therapeutic target .

  • Transplantation: Differentially expressed in liver and heart transplants, indicating a role in graft rejection or tolerance .

Diagnostic and Prognostic Applications

  • HBV Infection: FAM26F expression levels may serve as an early predictive marker for HBV infection .

  • Immunotherapy: Engineering FAM26F to enhance NK cell activation could improve outcomes in NK-sensitive cancers .

Mechanistic Insights

  • Redox-Calcium Crosstalk: FAM26F’s interaction with Thioredoxin links oxidative stress and calcium signaling, modulating immune responses .

  • Non-Classical Secretion: Signal peptide-independent secretion suggests unique trafficking mechanisms, potentially exploitable for drug delivery .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Calhm6; Fam26f; Calcium homeostasis modulator protein 6; Protein FAM26F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Calhm6
Target Protein Sequence
MEKFKAVLDLQIKHRSALGYGLVTLLTAGGEKIFSTVVFQCPCTATLNLTYGLVFLLVPA LALFLLGYALSARTWRLLTGCCSRSASTRSSSGLRSTLVCAQVSAVAALAPLTWVAVALL GGSFYQCAVSGSTRLASYLCKDRNHSCIAKLPQVPCNKQEAEMQEILSQLKAQSQVLGWV LIAAVIFLLLVFKCVSRCFSPVSYLQLKFWEIYLEKEKQILQSQAAEHATQLARENIRSF FECSKPKECNTPSRKDWQQISALYTFNSKNQFYSMLHKYVSRKEVSSSLHSVEGDVVVPV LGFVDDAAMANTHGV
Uniprot No.

Target Background

Function
Pore-forming subunit of a voltage-gated ion channel.
Database Links
Protein Families
CALHM family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FAM26F and what is its genomic location?

FAM26F is a member of the family with sequence similarity 26, located at chromosomal position 6q22.1 in humans. The FAM26F mRNA contains a 1141 bp coding region that encodes a 315 amino acid protein. Structural analysis indicates it is a relatively stable protein that has been well-conserved throughout evolution, suggesting its functional importance . The protein lacks a signal peptide but contains transmembrane domains, allowing it to function as an integral membrane protein that is secreted through non-classical pathways rather than conventional secretory routes .

What are the key structural domains and post-translational modifications of FAM26F?

FAM26F contains a single well-conserved Ca_hom_mod domain, indicating its function as a cation channel involved in molecular transport. Bioinformatic analyses have predicted one potential N-glycosylation site and 14 phosphorylation sites that may regulate its activity and interactions . The presence of an immunoglobulin-like (Ig-like) fold in the FAM26F structure further emphasizes its role in immune responses. These structural features provide insight into potential mechanisms through which FAM26F may influence cellular signaling and immune function .

How evolutionarily conserved is FAM26F across species?

Studies indicate that FAM26F is highly conserved across multiple species, suggesting fundamental biological importance. This conservation extends to both the primary sequence and the presence of key functional domains, particularly the Ca_hom_mod domain . The evolutionary conservation of FAM26F makes rat models particularly valuable for understanding its function in human health and disease, as the protein likely serves similar roles across mammalian species.

How is FAM26F transported and secreted from cells?

Despite lacking a conventional signal peptide, FAM26F is secreted through non-classical pathways. Under conditions of cellular stress or immune activation, FAM26F may be secreted from the ER through direct transportation to the plasma membrane or directly to the extracellular space, potentially with or without the use of secretory lysosomes . This unconventional secretion mechanism is similar to that observed for several other immune-related proteins, including proangiogenic fibroblast growth factor 2 (FGF2), inflammatory cytokines like IL-1β, IL-1α, IL-33, high-mobility group box 1 (HMGB1), and macrophage migration inhibitory factor .

What experimental methods are most effective for tracking FAM26F cellular localization?

For studying FAM26F localization, immunofluorescence combined with confocal microscopy has proven effective. Researchers typically use C-terminus GFP-tagged FAM26F plasmids for transfection experiments, allowing for visualization of the protein within cellular compartments . Co-localization studies with organelle-specific markers (particularly Golgi and ER markers) can further confirm subcellular distribution. For temporal studies of FAM26F expression and localization, researchers have determined that 24 hours post-transfection represents the optimal time point for maximum expression based on cell viability and caspase-3 activity assays .

How does FAM26F contribute to NK cell function and anti-tumor immunity?

FAM26F plays a critical role in natural killer (NK) cell activation against tumors. Studies in FAM26F-deficient (Inam-/-) mice demonstrated that while cytotoxicity against NK cell-sensitive tumor lines was only slightly decreased, the number of IFN-γ-producing cells was markedly reduced in the early phase of the immune response . The synergistic expression of FAM26F on both NK cells and myeloid dendritic cells (DCs) appears to be required for optimal NK cell activation against tumors, with this interaction mediated via the cytoplasmic tail of FAM26F . In tumor challenge models, FAM26F effectively suppressed lung metastasis of B16F10 melanoma cells through mechanisms dependent on NK1.1+ cells and IFN-γ production .

What is the relationship between FAM26F and interferon responses?

FAM26F expression is highly responsive to interferons and other inflammatory mediators. In vitro studies have shown that lymphocyte FAM26F expression increases approximately 40-fold following IFN-γ treatment . In vivo, FAM26F RNA levels in peripheral blood mononuclear cells correlate with plasma IFN-γ levels but not with IFN-α . Additionally, FAM26F is upregulated in response to various stimulants including polyI:C, LPS, IFN-γ, and TNF-α, suggesting its involvement in multiple inflammatory pathways including TLR3, TLR4, IFN-β, and Dectin-1 signaling .

What are the recommended protocols for FAM26F protein expression and purification?

For expression of recombinant FAM26F, researchers typically use mammalian expression systems with C-terminal tags for detection and purification. The experimental procedure involves:

  • Cloning the FAM26F coding sequence into an appropriate expression vector (e.g., with GFP tag)

  • Transfecting mammalian cells (HEK293T or similar) using standard transfection reagents

  • Optimizing expression by harvesting cells at 24 hours post-transfection, which has been determined as the optimal time point for maximum expression

  • Lysing cells using Tris-Triton lysis buffer (50 mM Tris-HCl pH 8.0, 1% Triton X-100, 0.5% CHAPS, 1 mM DTT) supplemented with protease and phosphatase inhibitors

  • Clearing cell debris by centrifugation at 14,000 rpm for 30 minutes at 4°C

  • Determining protein concentration using Bradford Assay

  • Confirming expression by immunoblotting using anti-FAM26F antibodies (1:1000 dilution)

For commercial applications, recombinant rat FAM26F protein is available in purified form for ELISA and other research applications .

What techniques are most effective for studying FAM26F interactions with other proteins?

Co-immunoprecipitation (co-IP) followed by mass spectrometry (MS/MS) has proven highly effective for identifying FAM26F-interacting proteins. This approach identified 85 proteins that co-purify with FAM26F, with 44 showing significant interaction . For validation of specific protein interactions, researchers can employ:

  • Co-immunoprecipitation with target-specific antibodies

  • Proximity ligation assays to visualize protein interactions in situ

  • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) to study dynamic interactions

  • Pull-down assays with purified recombinant proteins to confirm direct interactions

These methods revealed critical interactions between FAM26F and Thioredoxin, providing insight into its mechanism of action under stress or disease conditions .

How can FAM26F expression be accurately measured in biological samples?

For quantifying FAM26F expression in biological samples, researchers utilize several approaches:

  • Quantitative RT-PCR for mRNA expression analysis using FAM26F-specific primers

  • Immunoblotting for protein-level detection, using anti-FAM26F antibodies with chemiluminescence detection

  • Flow cytometry for cell-specific expression in mixed populations

  • ELISA using recombinant FAM26F standards for calibration

  • Microarray analysis for expression profiling in comparison with other genes

When measuring FAM26F expression, it's important to note that baseline expression appears stable for months in individual subjects, though expression levels can vary up to tenfold between individuals .

How does FAM26F influence calcium signaling and oxidative stress responses?

FAM26F plays a crucial role in calcium homeostasis and oxidative stress responses. The protein contains a Ca_hom_mod domain suggesting function as a cation channel . During immune activation, extracellular Ca²⁺ influx triggers effector functions, activating protein kinase C which then activates NADPH oxidase, leading to reactive oxygen species (ROS) production . FAM26F appears to regulate this process through:

  • Modulating Ca²⁺ release from intracellular stores (ER and Golgi)

  • Influencing the oxidation state of Thioredoxin (Trx), which detoxifies ROS

  • Potentially altering calcium gradients between the cytosol and organelles

  • Participating in signaling pathways that respond to altered Ca²⁺ and ROS levels

This dual role in calcium signaling and redox regulation positions FAM26F at a critical junction in cellular stress responses.

What therapeutic applications might target FAM26F in cancer and inflammatory diseases?

FAM26F shows promising therapeutic potential in several disease contexts:

  • Cancer immunotherapy: FAM26F upregulation has been associated with therapeutic benefit in metastatic melanoma and shown to suppress lung metastasis of B16F10 melanoma cells . Unlike Thioredoxin, which is elevated in numerous cancers and associated with tumor aggressiveness and immune suppression, FAM26F has demonstrated therapeutic potential against NK-sensitive and IFN-γ-suppressible tumors .

  • Inflammatory disease modulation: Given its role in calcium homeostasis and immune regulation, targeting FAM26F could potentially modulate inflammatory responses in autoimmune and inflammatory conditions.

  • Combined targeting approaches: Researchers propose that targeting FAM26F and Thioredoxin simultaneously may be more effective for optimizing redox regulation and immune system functioning .

How does the interaction between FAM26F and Thioredoxin influence immune cell activation and tumor suppression?

The interaction between FAM26F and Thioredoxin represents a critical regulatory node in immune function. Under cellular stress conditions, FAM26F interacts with Thioredoxin, potentially influencing whether immune activation or inhibition occurs . Research suggests that this interaction may determine whether FAM26F or Thioredoxin predominantly interacts with CD30R, with different immunological outcomes . While Thioredoxin is associated with tumor promotion, immune suppression, and poor survival in cancer patients, FAM26F appears to counter these effects by promoting anti-tumor immunity . Future research should focus on:

  • The structural basis of FAM26F-Thioredoxin interaction

  • The molecular switches that determine which protein predominates in CD30R binding

  • The downstream signaling pathways affected by these interactions

  • Potential therapeutic approaches to favor FAM26F-mediated immune activation over Thioredoxin-mediated suppression

What is the precise mechanism by which pre-infection FAM26F levels predict viral control during infection?

The observation that pre-infection FAM26F expression levels correlate inversely with viral load during SIV infection represents an intriguing biological phenomenon that requires further investigation . Several hypotheses could explain this relationship:

  • FAM26F may prime innate immune responses, enabling faster activation upon viral exposure

  • FAM26F expression might reflect the baseline activation state of specific immune cell subsets

  • FAM26F could influence the threshold for IFN-γ production by NK cells and T cells

  • Pre-existing FAM26F levels may determine the capacity for early viral control through yet-undefined mechanisms

Research approaches to address this question should include detailed temporal studies of immune activation following viral challenge in subjects with varying baseline FAM26F expression, and mechanistic studies using genetic manipulation of FAM26F in animal models.

How do post-translational modifications regulate FAM26F function and localization?

With 14 predicted phosphorylation sites and a potential N-glycosylation site, post-translational modifications likely play crucial roles in regulating FAM26F . Advanced research questions include:

  • Which kinases and phosphatases regulate FAM26F phosphorylation status?

  • How does phosphorylation influence FAM26F trafficking between the Golgi and ER?

  • Does glycosylation affect FAM26F interaction with binding partners like Thioredoxin?

  • Can targeting specific post-translational modifications provide therapeutic opportunities?

Techniques such as phospho-specific antibodies, site-directed mutagenesis, and mass spectrometry-based proteomic approaches will be essential to address these questions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.