Recombinant Rat Protein GPR108 (Gpr108)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Protein GPR108

Recombinant Rat Protein GPR108, also known as G protein-coupled receptor 108, is a member of the G protein-coupled receptor superfamily. It has been identified as a crucial entry factor for adeno-associated viruses (AAVs), which are widely used in gene therapy due to their safety profile and efficiency in delivering genetic material to cells. GPR108 plays a significant role in facilitating the entry of most AAV serotypes into cells, with the exception of AAV5, which does not require GPR108 for entry .

Structure and Function of GPR108

GPR108 is a seven-transmembrane receptor, typical of the GPCR family. It is highly conserved across species, including humans and rodents, which makes it an important target for studying AAV tropism and developing gene therapy models . The receptor's N- and C-terminal domains are essential for its function in AAV entry .

Key Features of GPR108:

  • Family: G protein-coupled receptor superfamily

  • Function: AAV entry factor, involved in immune modulation and NF-κB signaling

  • Species Conservation: Highly conserved between humans and rodents

Role in Adeno-Associated Virus (AAV) Entry

GPR108 is critical for the efficient entry of AAVs into cells. It acts alongside another entry factor, AAVR, to facilitate the transduction process. The absence of GPR108 significantly reduces the ability of most AAV serotypes to enter cells, except for AAV5, which is GPR108-independent .

AAV Serotypes and GPR108 Dependency:

AAV SerotypeGPR108 Dependency
AAV5Independent
AAV8Dependent
AAVrh32.33Dependent

Research Findings and Applications

Research on GPR108 has provided valuable insights into the mechanisms of AAV entry and has implications for gene therapy. The identification of GPR108 as a conserved entry factor across species supports its potential use in developing more effective gene therapy vectors .

Applications of GPR108 Research:

  • Gene Therapy: Understanding GPR108's role in AAV entry can improve vector design and targeting efficiency.

  • Basic Research: Insights into GPR108's function contribute to understanding cellular immune responses and signaling pathways.

Recombinant Protein Production and Use

While specific information on recombinant rat GPR108 protein production is limited, recombinant proteins are generally produced using expression systems like E. coli or mammalian cells. These proteins are used in various applications, including Western blotting, immunohistochemistry, and functional assays to study protein function and interactions .

Recombinant Protein Applications:

ApplicationDescription
Western BlotDetects protein expression levels
ImmunohistochemistryLocalizes protein in tissues
Functional AssaysStudies protein activity and interactions

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our proteins depends on several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Gpr108; Protein GPR108
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-577
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Gpr108
Target Protein Sequence
RIHRLTLTGEKRADIQLNSFGFYTNGSLEVELSLLRLSLQETEDKFPKVGFSLSRVRSGS VRSYSSRNSHECPLERNSSNFLVLFLINIKDLQVQVRKYGEQKLFISPGLLPEAPSQSGP PKPDPTGTPKDNHVIHPSPKKMSAVKEDQAKLTVPQVSGDKALPAGHRHSSDGQPQSQPP TRGPSGKEKDLVLGLGHLNDSYNFSFHIVIGSRAEEGQYSLNFHNCYNTIPGQEQPFDLT VMIREKNPEGFLSAAEIPLFKLYLIMSACFLAAGIFWVSVLCKNTYSVFKIHWLMAALAF TKSVSLLFHSINYYFINSQGHPIEGLAVMHYITHLLKGALLFITIALIGSGWAFVKYMLS DKEKKIFGIVIPLQVLANVAYIVIESREEGASDYGLWKEILFLVDLICCGAILFPVVWSI RHLQDASGTDGKVAMNLAKLKLFRHYYVMVICYIYFTRIIAILLRVAVPFQWQWLYQLLV ESSTLAFFVLTGYKFQPAGDNPYLQLPQQEDEEDVQMEQVMTDSGFREGLSKVNKTASGR ELL
Uniprot No.

Target Background

Database Links
Protein Families
LU7TM family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.