Recombinant Rat Protein JTB (Jtb)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Protein JTB (Jtb)

Recombinant Rat Protein JTB (Jtb) is a bioengineered protein derived from the jumping translocation breakpoint gene in Rattus norvegicus. It is produced through recombinant DNA technology, typically expressed in mammalian or insect cell systems, and is used in research to study its role in cellular processes, cancer biology, and therapeutic development. The protein is characterized by its cysteine-rich extracellular domain, transmembrane helix, and cytoplasmic tail, mirroring its endogenous structure .

Key Features of Recombinant Rat JTB

PropertyDetails
GeneJtb (jumping translocation breakpoint)
AccessionUniProt ID: O88823
SequencePartial or full-length; includes conserved cysteine motifs
Molecular Weight~16.4 kDa (predicted for full-length)
Expression HostMammalian cells (e.g., HEK293) or baculovirus systems
TagHis-tag (common), Fc-tag (human variants only)

Key Technical Details

  • Endotoxin Levels: <1.0 EU/μg (LAL method) .

  • Reconstitution: Lyophilized protein dissolved in sterile PBS or deionized water .

  • Stability: Aliquots stable at -20°C for 3 months; avoid repeated freeze-thaw cycles .

Toxicology and Gene-Environmental Interactions

Rat JTB is linked to environmental toxin responses:

  • Carcinogens: Downregulated by 1,2-dimethylhydrazine and bisphenol A .

  • Heavy Metals: Cadmium chloride increases JTB expression, suggesting stress-response roles .

Table 1: Rat JTB Gene-Chemical Interactions

ChemicalEffectEvidence
Cadmium Chloride↑ JTB expressionCTD PMID:33453195
Bisphenol A↓ JTB expression; ↑ DNA methylationCTD PMID:33296240, 28505145
Chlorpyrifos↑ JTB expressionCTD PMID:37019170

Table 2: Functional Pathways Associated with JTB

PathwayHuman Homolog InsightsRelevance to Rat JTB
Mitotic SpindleEnsures chromosome segregation Potential role in cytokinesis
EMTDrives metastasis Cytoskeletal remodeling
Oxidative StressRegulates apoptosis Mitochondrial dysfunction

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
Jtb; Protein JTB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-146
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Jtb
Target Protein Sequence
EAPVREEKLSVSTSTSPCWLVEEFVVTEECTPCSNFQIKTTPECGSTGYVEKITCSSSKRNEFKSCRSALLEQHLFWKFEGIVVGVALVFACLVIIRQRQLDRKALEKVRKQIESI
Uniprot No.

Target Background

Function
Recombinant Rat Protein JTB (Jtb) is essential for normal cytokinesis during mitosis and plays a role in regulating cell proliferation. It may be a component of the chromosomal passenger complex (CPC), a critical regulator of mitosis. The CPC complex is crucial for centromere function, ensuring accurate chromosome alignment and segregation. Furthermore, it's required for chromatin-induced microtubule stabilization and spindle assembly. JTB enhances AURKB activity and inhibits TGFβ1-induced apoptosis. Overexpression leads to mitochondrial swelling and reduced mitochondrial membrane potential.
Database Links
Protein Families
JTB family
Subcellular Location
Membrane; Single-pass type I membrane protein. Mitochondrion. Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle.

Q&A

What is the basic structure and characteristics of the JTB protein?

JTB protein consists of 146 amino acids with a molecular weight of approximately 16.4 kDa. The protein structure includes several distinct domains: a signal sequence at the N-terminus, a cysteine-rich extracellular domain, a hydrophobic transmembrane domain, and an intracellular/cytoplasmic domain . The ectodomain of JTB comprises a distinctive βαββ fold resembling an "open hand" where a three-strand β-sheet forms the palm and fingers, while a short inserted helix serves as the outstretched thumb .

The protein contains a unique six-cysteine motif that forms three disulfide bridges: two (C9-C46 and C21-C57) stabilize the β-strand meander fold, while the third (C24-C35) connects the N- and C-termini of the short helix inserted between the first and second β-strands . This distinctive structure creates a conserved patch on the concave face of the protein that likely serves as an interaction site for protein or extracellular matrix ligands .

How is the JTB gene organized in the genome and what are its expression patterns?

The human JTB gene is located on chromosome 1q21 and is involved in unbalanced translocation in various cancer types, including lung, stomach, colon, breast, and prostate cancers . In these cancer-associated chromosomal abnormalities, a JTB gene fragment lacking the 3' exon (which encodes the transmembrane helix and short cytoplasmic tail) undergoes translocation to different chromosomes where it fuses with stretches of telomeric repeats . This results in multiple copies of a shortened gene that produces excess amounts of a secreted JTB ectodomain .

JTB protein is ubiquitously expressed in normal tissues but exhibits altered expression (either overexpression or downregulation) in various cancer types. The protein is notably well-conserved from nematodes to humans, suggesting fundamental biological importance .

What are the primary functions of JTB in normal cellular processes?

While the complete functional profile of JTB remains under investigation, research indicates that JTB plays roles in several crucial cellular processes. In normal cells, JTB is implicated in:

  • Regulation of mitochondrial organization and function

  • Modulation of cytoskeleton organization

  • Influence on apical junctional complex dynamics

  • Involvement in cellular proteostasis pathways

  • Participation in interferon alpha and gamma signaling

JTB appears to interact with multiple protein partners across these processes, suggesting a complex role in cellular homeostasis. The protein's highly conserved nature across species points to its evolutionary importance in fundamental cellular functions.

How does JTB dysregulation influence cancer progression and metastasis?

JTB dysregulation has been demonstrated to significantly impact cancer cell behavior through multiple mechanisms. Proteomics analyses of JTB-upregulated and JTB-downregulated cancer cell lines reveal that JTB influences:

  • Epithelial-mesenchymal transition (EMT): JTB dysregulation increases EMT potential, enhancing the migratory and invasive capabilities of cancer cells.

  • Cell proliferation: Altered JTB expression affects cell cycle regulation and proliferative capacity.

  • Metabolic reprogramming: JTB influences cellular metabolism, contributing to the cancer-associated metabolic phenotype.

  • Resistance to apoptosis: JTB modulates apoptotic pathways, potentially contributing to therapy resistance .

In breast cancer research specifically, JTB dysregulation in MCF7 cells (a typically non-invasive luminal type A breast cancer cell line) promotes a more aggressive phenotype through synergistic upregulation of EMT, mitotic spindle, and fatty acid metabolism pathways . This transition toward more aggressive behavior appears to be mediated through specific JTB-related protein interactions.

What molecular pathways are affected by JTB dysregulation based on proteomic studies?

Proteomic analysis of JTB-dysregulated cells reveals impacts on multiple cellular pathways and processes. The table below summarizes key pathways affected by JTB dysregulation as identified through normalized enrichment score (NES) analysis:

PathwaysNESFDR q-Val
UpregulatedCOMPLEMENT1.23
INTERFERON GAMMA RESPONSE1.071
UNFOLDED PROTEIN RESPONSE (UPR)11
DownregulatedCHOLESTEROL HOMEOSTASIS−1.56
GLYCOLYSIS−1.450.239
E2F TARGETS−1.440.187
APICAL JUNCTION−1.320.297
HYPOXIA−1.180.465
MYC TARGETS V2−1.090.534

(NES-normalized enrichment score; FDR q-val-false discovery rate q-value)

These pathway alterations collectively suggest that JTB influences fundamental cellular processes including metabolism, stress response, cell adhesion, and proliferation control mechanisms.

How does JTB influence ribosome biogenesis and what are the implications for cancer research?

Proteomics investigations have revealed a significant connection between JTB and ribosome biogenesis, which has important implications for cancer research. JTB dysregulation affects multiple ribosomal proteins, including:

  • 40S ribosomal protein S14 (RPS14): Upregulated in JTB-overexpressed conditions, RPS14 is indispensable for ribosomal biogenesis and highly expressed in ER+ breast cancer tissues. Its downregulation significantly inhibits cell proliferation, cell cycle progression, and metastasis while inducing apoptosis and activating interferon signaling pathways.

  • Human 60S ribosomal protein L6 (RPL6): Also upregulated in JTB-overexpressed conditions, RPL6 has been reported as overexpressed in multidrug-resistant gastric cancer cells. Its upregulation accelerates growth, enhances colony-forming ability, and promotes anti-apoptosis mechanisms.

  • 40S ribosomal protein S5 (RPS5): Downregulated in JTB-downregulated conditions, RPS5 negatively regulates p53 expression and plays an anti-apoptotic role in cancer cells, contributing to resistance against MEK inhibitor-induced cell death .

The connection between JTB and ribosome biogenesis is particularly significant because hyperactivation of ribosome biogenesis and aberrant ribosome homeostasis are recognized hallmarks of cancer. Cancer cells often harbor specific "onco-ribosomes" that facilitate oncogenic translation programs and promote metabolic reprogramming, contributing to metastasis and therapeutic resistance .

What experimental approaches are most effective for studying JTB protein structure?

The complex structure of JTB, particularly its distinctive cysteine-rich domain with specific disulfide connectivity, presents unique challenges for structural analysis. Based on successful structural determination approaches, the following methodologies are recommended:

  • Recombinant protein production: Expression of JTB in E. coli systems has proven effective for generating stable protein for structural studies. Careful attention to maintaining the correct disulfide connectivity is essential.

  • Nuclear Magnetic Resonance (NMR) spectroscopy: This approach has been successfully applied to determine the solution structure of human JTB ectodomain (PDB file 2KJX), revealing the distinctive βαββ fold with its characteristic disulfide bridges .

  • Comparative structural analysis: Structural comparison tools like the SSM server can help identify structural homologs, which may provide insights into functional mechanisms. For instance, JTB shows structural similarity to the N-terminal Cys-rich domain of midkine, a heparin-binding growth factor .

  • Computational prediction approaches: While computational methods have historically struggled with accurately predicting JTB structure (particularly the disulfide connectivity and the looped-out helix α1), they can complement experimental approaches when used with appropriate constraints from experimental data .

What proteomics techniques are most suitable for investigating JTB-related protein interactions?

Based on successful research approaches, the following proteomics techniques are recommended for studying JTB protein interactions:

  • In-solution digestion-based cellular proteomics: This approach has proven complementary to in-gel based proteomics for investigating protein dysregulation patterns associated with JTB. The method effectively identifies JTB-interacting partners and affected pathways when comparing control cells with those exhibiting upregulated or downregulated JTB expression .

  • Integrated proteomics approach: Combining multiple proteomics methodologies (such as in-gel and in-solution approaches) provides a more comprehensive view of JTB-related protein networks. This integrated approach has successfully revealed complementary sets of JTB-related proteins in breast cancer cell models .

  • Pathway enrichment analysis: Techniques like Gene Set Enrichment Analysis (GSEA) can effectively identify biological pathways and processes affected by JTB dysregulation, providing a systems-level understanding of JTB function .

  • Functional classification of JTB-interacting proteins: Categorizing identified proteins according to their protumorigenic or antitumorigenic roles provides valuable insights into the complex effects of JTB dysregulation in cancer contexts .

What cellular models are most appropriate for studying JTB function?

Selection of appropriate cellular models is crucial for meaningful JTB research. Based on successful research approaches, consider the following:

  • MCF7 breast cancer cell line: This luminal type A non-invasive/poor-invasive human breast cancer cell line has been effectively used to study JTB's role in cancer progression. Transfection approaches for both overexpression and downregulation of JTB in MCF7 cells have revealed significant insights into JTB's effects on cancer cell phenotype and behavior .

  • Comparative studies with invasive cell lines: Pairing studies in non-invasive cell lines like MCF7 with parallel investigations in highly invasive lines like MDA-MB-231 can provide valuable contrasts in understanding JTB's role in cancer progression .

  • Genetic manipulation methods: Effective approaches include transfection for overexpression of JTB and RNA interference techniques for downregulation. These complementary approaches provide a more complete picture of JTB function than either approach alone .

What are the main technical challenges in studying JTB structure-function relationships?

Several technical challenges complicate the study of JTB structure-function relationships:

  • Disulfide connectivity prediction: The distinctive six-cysteine motif in JTB forms a specific pattern of disulfide bridges that has proven difficult to predict computationally. This complicates both structural modeling and the design of functional studies .

  • Transmembrane domain analysis: As JTB is a transmembrane protein, studying its full structure (including the membrane-spanning region) presents technical difficulties that are not addressed by soluble domain analysis alone.

  • Identification of physiological binding partners: While JTB's structure suggests a conserved interaction surface, the identification of its natural binding partners remains challenging and requires specialized interaction screening approaches.

  • Reconciling varied cancer effects: JTB can be either overexpressed or downregulated in different cancer contexts, creating a complex picture of its role in cancer biology that requires careful experimental design to unravel .

How can researchers effectively study the role of JTB in epithelial-mesenchymal transition?

Based on current research approaches, the following methodologies are recommended for investigating JTB's role in EMT:

  • Multi-omics integration: Combining proteomics with transcriptomics and metabolomics can provide a comprehensive view of how JTB affects the EMT program.

  • EMT marker analysis: Systematic assessment of classic EMT markers (E-cadherin, N-cadherin, vimentin, etc.) in JTB-modulated cells can establish direct connections between JTB levels and EMT status.

  • Cytoskeletal organization studies: As JTB affects cytoskeleton organization, imaging-based approaches to visualize cytoskeletal changes in response to JTB modulation can provide mechanistic insights into how JTB influences cell motility and invasiveness .

  • Pathway-specific inhibitors: Using targeted inhibitors of EMT-related pathways (TGF-β, Wnt, etc.) in JTB-modulated cells can help delineate the specific mechanisms through which JTB influences the EMT program.

What emerging technologies might advance our understanding of JTB biology?

Several emerging technologies hold promise for deepening our understanding of JTB biology:

  • Single-molecule techniques: Methods like single-molecule FRET or supported lipid bilayer approaches with engineered recombinant proteins (as described for PI3Kβ studies) could provide valuable insights into JTB's molecular interactions and dynamics .

  • CRISPR-based genetic screening: Systematic genetic screens using CRISPR technology could help identify genes that synthetically interact with JTB, revealing new functional connections.

  • Cryo-electron microscopy: This rapidly advancing technique could potentially resolve the structure of full-length JTB, including its transmembrane domain, providing a more complete structural picture than currently available.

  • Advanced live-cell imaging: Techniques like lattice light-sheet microscopy could enable real-time visualization of JTB dynamics in living cells, providing insights into its trafficking and interaction behaviors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.