Recombinant Rat Protein Mpv17 (Mpv17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate your needs during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which customers can use as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mpv17; Mpv17l; Protein Mpv17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mpv17
Target Protein Sequence
MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQQHQTGRTLTMASLGCG FVGPVVGGWYRVLDHLIPGTTKVNALKKMLLDQGGFAPCFLGCFLPLVGVLNGMSAQDNW AKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVVWNSYLSWKAHQL
Uniprot No.

Target Background

Function
Mpv17 is a non-selective channel that regulates membrane potential under normal conditions and oxidative stress. It plays a role in mitochondrial homeostasis, including mitochondrial deoxynucleoside triphosphates (dNTP) pool homeostasis and mitochondrial DNA (mtDNA) maintenance. Mpv17 may also be involved in the regulation of reactive oxygen species metabolism and the control of oxidative phosphorylation.
Gene References Into Functions
  1. Mpv17 expression increased following intracerebral hemorrhage. PMID: 26123482
Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MPV17 protein and what is its cellular localization?

MPV17 is an inner mitochondrial membrane protein that forms a non-selective channel with a pore diameter of approximately 1.8 nm. The protein contains four transmembrane spanning domains and is embedded in the inner mitochondrial membrane. While lacking a cleavable N-terminal mitochondrial targeting sequence, MPV17 contains internal targeting signals that direct it to mitochondria . This localization is critical for its function in maintaining mitochondrial homeostasis and energy metabolism. Experimental confirmation of mitochondrial localization can be achieved through subcellular fractionation followed by Western blotting or immunofluorescence microscopy using specific anti-MPV17 antibodies.

What is the structural and functional characterization of recombinant MPV17?

Recombinant MPV17 forms a non-selective channel with several key characteristics:

  • Pore diameter: 1.8 nm

  • Selectivity: Weakly cation-selective

  • Conductance properties: Exhibits multiple subconductance states

  • Gating mechanism: Voltage-dependent, regulated by redox conditions and pH

The channel's function appears to be primarily modulating the mitochondrial membrane potential (Δψm), which is essential for maintaining mitochondrial homeostasis. Electrophysiological measurements with recombinant MPV17 have been instrumental in characterizing these properties. The voltage-dependent gating of the channel is affected by mutations mimicking phosphorylated states, suggesting post-translational regulation is important for its function .

How do mutations in MPV17 affect mitochondrial function?

Mutations in MPV17 lead to mitochondrial DNA depletion syndrome (MDDS), an inherited autosomal recessive disease . Studies using knockout models have revealed several consequences of MPV17 deficiency:

ParameterWild-typeMPV17-deficientSignificance
Mitochondrial membrane potential (Δψm)NormalElevatedDisrupts energy homeostasis
Reactive oxygen species (ROS) productionNormalIncreasedContributes to oxidative damage
Mitochondrial morphologyNormal fusion/fission balanceAccelerated fissionAffects mitochondrial quality control
ATP productionNormalReducedImpairs cellular energy supply
Triglyceride (TAG) contentNormalDecreasedDisrupts energy storage

These alterations collectively contribute to premature aging phenotypes observed in Mpv17-deficient mice and developmental defects in zebrafish models .

What are the optimal methods for expressing and purifying recombinant rat MPV17 protein?

The expression and purification of recombinant rat MPV17 require careful optimization due to its hydrophobic nature as a membrane protein. A proven methodology includes:

Expression System Selection:

  • Yeast expression systems like Pichia pastoris (strain SMD1163) have been successfully used for MPV17 expression

  • Mammalian expression systems may provide more physiologically relevant post-translational modifications

Expression Protocol:

  • Transform the expression construct into your chosen host

  • For P. pastoris, culture in BMGY medium (1.0% yeast extract, 2.0% peptone, 1.34% yeast nitrogen base, 1.0% glycerol, 4×10^-5% biotin in 100 mM potassium phosphate buffer, pH 6.0)

  • Induce protein expression using BMMY medium with 0.5% methanol instead of glycerol

  • Harvest cells after 18-24 hours of induction

Purification Strategy:

  • Isolate membrane fraction using differential centrifugation

  • Solubilize membrane proteins using 2.0% Fos-choline-12 in 20 mM potassium phosphate buffer (pH 7.4) with 10% glycerol and protease inhibitors

  • Purify using nickel-nitrilotriacetic acid affinity chromatography with appropriate binding, washing, and elution buffers

  • Verify purity using SDS-PAGE and Western blotting

This methodology has yielded functional recombinant MPV17 protein suitable for structural and functional studies.

How can researchers effectively design MPV17 mutants to study structure-function relationships?

Design and analysis of MPV17 mutants require careful consideration of conserved regions and functional domains:

Mutation Design Strategy:

  • Identify conserved residues across species using multiple sequence alignment

  • Target residues within the channel's selectivity filter and transmembrane domains

  • Create phosphomimetic mutants (e.g., T80D) to study regulation by phosphorylation

  • Design mutations that mimic disease-associated variants (e.g., P98L)

Mutagenesis Protocol:

  • Use site-directed mutagenesis techniques such as QuikChange with appropriate primers

  • Example primers for targeting key residues:

    • p.D92K: 5′-GCA CTG AAG AAG ATG TTG TTG AAG CAG GGG GGC TTT GC-3′ (forward)

    • p.P98L: 5′-TCA GGG GGG CTT TGC CTT GTG TTT TCT AGG CTG C-3′ (forward)

    • p.T80A: 5′-TCG GTT CAT CCC TGG CGC TAC CAA AGT GGA TGC AC-3′ (forward)

    • p.T80D: 5′-ATC GGT TCA TCC CTG GCG ACA CCA AAG TGG ATG CAC-3′ (forward)

  • Verify mutations by sequencing before expression

Functional Assessment:

  • Electrophysiological measurements to assess channel properties

  • Membrane potential assays to evaluate Δψm regulation

  • Complementation studies in knockout models to assess rescue of phenotypes

This approach allows for systematic investigation of the structure-function relationships of MPV17.

What controls should be included when studying the effects of MPV17 knockdown or knockout?

Rigorous control strategies are essential for accurate interpretation of MPV17 deficiency studies:

Genetic Controls:

  • Wild-type controls from the same genetic background

  • Heterozygous models to assess gene dosage effects

  • Rescue experiments with wild-type MPV17 to confirm phenotype specificity

  • Expression of mutant MPV17 variants to assess structure-function relationships

Methodological Controls:

  • Multiple independent knockout or knockdown lines to account for off-target effects

  • Time-course studies to distinguish primary from secondary effects

  • Tissue-specific knockouts to assess cell-type specific requirements

Phenotypic Assessment Controls:

  • Monitor multiple mitochondrial parameters:

    • Mitochondrial DNA content (qPCR)

    • Membrane potential (using JC-1 or TMRM dyes)

    • ROS production (using MitoSOX or H2DCFDA)

    • ATP levels (luciferase-based assays)

    • Mitochondrial morphology (electron microscopy)

  • Assess parameters under both basal and stressed conditions

Following these control strategies ensures robust and reproducible results when studying MPV17 function.

How can researchers effectively study the interaction between MPV17 and mitochondrial DNA maintenance?

MPV17 mutations cause mitochondrial DNA depletion syndrome, suggesting a critical role in mtDNA maintenance. Advanced approaches to study this interaction include:

Quantitative Analysis of mtDNA:

  • Real-time qPCR to measure mtDNA copy number relative to nuclear DNA

  • Southern blot analysis to detect mtDNA deletions

  • Long-range PCR to assess mtDNA integrity

  • Next-generation sequencing to identify mtDNA mutations

Nucleotide Pool Analysis:

  • HPLC or LC-MS/MS to measure mitochondrial dNTP pools

  • Isotope labeling to track nucleotide incorporation into mtDNA

  • Assessment of mitochondrial salvage pathway enzymes by activity assays

DNA-Protein Interaction Studies:

  • Chromatin immunoprecipitation (ChIP) adapted for mitochondria

  • Proximity ligation assays to detect interactions with mtDNA replication machinery

  • Co-immunoprecipitation to identify interaction partners involved in mtDNA maintenance

These methodologies provide comprehensive insights into how MPV17 contributes to mtDNA stability and replication.

What are the approaches to reconcile contradictory data on MPV17 function across different experimental models?

Research on MPV17 has produced seemingly contradictory results across different model systems. Reconciling these discrepancies requires:

Systematic Cross-Model Comparison:

ModelReported PhenotypesPotential Reconciliation Approach
MicePremature aging, glomerulosclerosis, increased ROS production Age and tissue-specific analyses to identify primary vs. secondary effects
ZebrafishDevelopmental defects in muscles and liver, decreased TAG content Metabolic profiling to link channel function to specific metabolic pathways
Cell linesVariable mtDNA depletion phenotypesStandardized culture conditions and genetic background controls
PatientsHepatocerebral mtDNA depletion, variable onset and severityGenotype-phenotype correlation studies with larger cohorts

Integrative Multi-omics Approach:

  • Combine transcriptomics, proteomics, and metabolomics data across models

  • Network analysis to identify conserved pathways despite phenotypic differences

  • Time-resolved analysis to distinguish primary from secondary effects

Standardized Methodological Framework:

  • Develop consensus protocols for measuring key parameters

  • Use identical environmental conditions when comparing models

  • Implement cross-laboratory validation studies

This comprehensive approach can resolve apparent contradictions and lead to a unified understanding of MPV17 function.

How can the channel properties of MPV17 be accurately measured in vitro and in vivo?

Accurate measurement of MPV17 channel properties requires sophisticated methodologies:

In Vitro Methodologies:

  • Electrophysiological measurements:

    • Planar lipid bilayer recordings using purified recombinant protein

    • Patch-clamp of reconstituted proteoliposomes

    • Voltage protocols to assess gating properties under various conditions (pH, redox state)

  • Fluorescence-based flux assays:

    • Liposome-encapsulated fluorescent dyes responsive to ions or metabolites

    • Stopped-flow spectroscopy to measure rapid kinetics

In Vivo/Cellular Methodologies:

  • Mitochondrial membrane potential measurements:

    • Potentiometric dyes (TMRM, JC-1) with live-cell imaging

    • Time-resolved fluorescence to capture dynamic changes

  • Metabolite transport assays:

    • Isotope-labeled substrate uptake by isolated mitochondria

    • Metabolomic profiling of mitochondrial matrix content

Data Analysis Considerations:

  • Single-channel vs. whole-cell/organelle measurements

  • Correction for background conductances

  • Statistical analysis of subconductance states

  • Kinetic modeling of voltage-dependent gating

These approaches provide complementary insights into the channel properties of MPV17 in different experimental contexts.

What strategies can address the challenges of MPV17 protein solubility and stability during purification?

Membrane proteins like MPV17 present significant purification challenges. Effective troubleshooting strategies include:

Solubilization Optimization:

  • Screen multiple detergents:

    • Fos-choline-12 has proven effective (2.0% w/v for solubilization, 0.5% for purification)

    • Test alternatives like DDM, LMNG, or SMA copolymers

  • Optimize detergent-to-protein ratio

  • Consider detergent mixtures for improved extraction

Stability Enhancement:

  • Include stabilizing additives:

    • 10% glycerol in all buffers

    • Lipid supplements (e.g., cholesterol, cardiolipin)

    • Specific ions based on physiological environment

  • Optimize buffer conditions:

    • Test pH range 6.0-8.0

    • Vary ionic strength (150-500 mM NaCl)

  • Consider protein engineering approaches:

    • Thermostabilizing mutations

    • Fusion partners to enhance solubility

Quality Control Checkpoints:

  • SEC-MALS to assess monodispersity

  • Circular dichroism to verify secondary structure

  • Thermal shift assays to quantify stability

  • Functional assays to confirm activity after purification

Implementing these strategies can significantly improve the yield and quality of purified MPV17 protein.

How can researchers resolve inconsistent results when measuring mitochondrial phenotypes in MPV17-deficient models?

Inconsistent phenotypes in MPV17 research may arise from methodological variations. Standardization approaches include:

Experimental Design Standardization:

  • Control for genetic background effects:

    • Use littermate controls

    • Back-cross knockout lines to standardized backgrounds

    • Generate isogenic cell lines using CRISPR/Cas9

  • Account for environmental variables:

    • Standardize culture conditions (media, serum, passage number)

    • Control for circadian effects in animal studies

    • Document nutritional status (fed vs. fasted)

Phenotyping Methodology Standardization:

  • Membrane potential measurements:

    • Standardize dye concentration and loading time

    • Control for plasma membrane potential effects

    • Use internal controls for calibration

  • ROS measurements:

    • Compare multiple detection methods

    • Include positive controls (e.g., antimycin A treatment)

    • Normalize to mitochondrial mass

Data Integration Approach:

  • Measure multiple parameters in the same samples

  • Establish correlations between different phenotypic readouts

  • Develop composite phenotypic scores that integrate multiple measurements

These standardization approaches can reduce variability and increase reproducibility of MPV17 research.

What are the best approaches to interpret age-dependent and tissue-specific effects of MPV17 deficiency?

MPV17 deficiency produces complex phenotypes that vary with age and tissue type. Effective interpretation requires:

Age-Dependent Analysis Framework:

  • Time-course studies spanning development to aging:

    • Embryonic (developmental effects)

    • Young adult (compensatory mechanisms)

    • Aging (cumulative defects)

  • Longitudinal studies in the same animals when possible

  • Age-matched controls for all experiments

Tissue-Specificity Investigation:

  • Comprehensive tissue panel analysis:

    • Prioritize high-energy tissues (liver, muscle, brain, kidney)

    • Compare oxidative vs. glycolytic tissues

    • Assess tissues with different mtDNA replication rates

  • Tissue-specific knockout models to distinguish autonomous effects

  • Cell type-specific analysis within heterogeneous tissues

Integrative Data Analysis:

  • Correlation analysis between:

    • Tissue-specific metabolic demands

    • MPV17 expression levels

    • Severity of phenotypes

  • Pathway analysis to identify tissue-specific vulnerabilities

  • Mathematical modeling of age-dependent accumulation of defects

This methodical approach can untangle the complex phenotypic manifestations of MPV17 deficiency across ages and tissues.

How might novel methodologies advance our understanding of MPV17's role in metabolite transport?

Recent characterization of MPV17 as a non-selective channel opens new research possibilities for metabolite transport studies:

Advanced Transport Assays:

  • Reconstitution of purified MPV17 in nanodiscs for controlled transport studies

  • Development of fluorescent metabolite sensors for real-time transport monitoring

  • Application of microfluidic devices for single-organelle metabolite flux measurements

Candidate Metabolite Screening:

  • Systematic testing of physiologically relevant molecules:

    • Nucleotides and precursors

    • TCA cycle intermediates

    • Redox-active molecules

  • Competition assays to determine relative transport preferences

  • Structure-activity relationship studies to identify molecular determinants of transport

In Silico Modeling:

  • Molecular dynamics simulations of channel-metabolite interactions

  • Predictive models of transport selectivity based on metabolite properties

  • Systems biology approaches to predict metabolic consequences of altered transport

These approaches could definitively identify the physiological cargo of the MPV17 channel and its relevance to mitochondrial DNA maintenance.

What experimental designs would best elucidate the relationship between MPV17 function and aging processes?

The premature aging phenotype in MPV17-deficient mice warrants sophisticated aging research approaches:

Aging Biomarker Analysis:

  • Comprehensive assessment of established aging markers:

    • Telomere length

    • DNA damage accumulation

    • Senescence-associated β-galactosidase activity

    • Inflammaging markers

  • Epigenetic clock analysis using methylation patterns

  • Proteostasis and autophagy/mitophagy capacity assessment

Interventional Studies:

  • Test whether aging interventions rescue MPV17 deficiency phenotypes:

    • Caloric restriction

    • NAD+ precursors

    • Mitochondrial-targeted antioxidants

    • Senolytic compounds

  • Genetic interaction studies with longevity genes (e.g., SIRT1, FOXO3)

Multi-generational Analysis:

  • Investigate transgenerational effects of MPV17 deficiency

  • Assess mitochondrial quality control across generations

  • Evaluate mtDNA mutation accumulation rates in successive generations

These experimental approaches would position MPV17 research within the broader context of aging biology.

How can researchers design therapeutic strategies targeting MPV17-related mitochondrial dysfunction?

Translating MPV17 research into therapeutic applications requires targeted approaches:

Therapeutic Target Identification:

  • High-throughput screening for:

    • Channel activity modulators

    • Compounds that stabilize mitochondrial membrane potential

    • Enhancers of alternative metabolite transport pathways

  • Gene therapy approaches:

    • AAV-mediated MPV17 delivery to affected tissues

    • Antisense oligonucleotides for splice-modulation of specific mutations

  • Metabolic bypass strategies:

    • Supplementation with downstream metabolites

    • Activation of compensatory metabolic pathways

Preclinical Model Development:

  • Humanized mouse models expressing patient-specific mutations

  • Patient-derived iPSC differentiated into affected cell types

  • Organoid models of affected tissues for compound screening

Treatment Efficacy Assessment:

  • Development of biomarkers for treatment response:

    • mtDNA copy number

    • Metabolite profiles

    • Tissue-specific functional readouts

  • Non-invasive monitoring methods:

    • Metabolic imaging

    • Circulating mtDNA analysis

    • Functional capacity assessments

These therapeutic research directions could translate basic MPV17 science into clinical applications for mitochondrial DNA depletion syndrome patients.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.