Recombinant Rat Protein reprimo (Rprm)

Shipped with Ice Packs
In Stock

Description

Production Methods

Rprm is synthesized using prokaryotic or cell-free systems:

Production SystemHostExpression Features
ProkaryoticE. coliHigh yield; His-tag/MBP-tag fusion for affinity purification
Cell-FreeCFPS systemsEnables post-translational modifications (e.g., glycosylation)

Prokaryotic systems dominate due to cost efficiency and scalability, while cell-free methods (e.g., Nicotiana tabacum lysates) address complex folding challenges .

Applications in Research

Recombinant Rat Rprm is utilized across multiple experimental platforms:

ApplicationPurposeExample
ELISAQuantify Rprm levels in serum, plasma, or lysates Detecting tumor suppressor activity in cancer models
Western BlottingValidate Rprm expression and post-translational modifications Confirming proteasomal degradation pathways
ImmunoprecipitationStudy protein-protein interactions (e.g., with CDK1 or cyclin B1) Mapping Rprm’s role in G2/M arrest
Functional StudiesInvestigate extrinsic apoptosis induction via Hippo-YAP/TAZ-p73 axis Testing Rprm’s secretory function in vitro

Role in Tumor Suppression

Rprm’s recombinant form has been instrumental in elucidating its mechanisms:

  • Cell Cycle Arrest: Inhibits CDK1 activity and nuclear translocation of cyclin B1, inducing G2 arrest . Overexpression in pituitary cells reduces proliferation by 55% and enhances apoptosis under stress .

  • Extrinsic Apoptosis: Secreted Rprm binds protocadherins (FAT1, FAT4, CELSRs), activating Hippo signaling to induce apoptosis via p73 . This pathway is disrupted in cancers with hypermethylated RPRM promoters .

  • Radiation Response: Rprm knockout in rat models reduces DNA damage and apoptosis post-irradiation, highlighting its role in radiosensitivity .

Technical Challenges

  • Proteasomal Degradation: Rprm protein is rapidly degraded (half-life <4 hours), requiring stabilization under stress conditions .

  • Methylation-Driven Silencing: Promoter hypermethylation in gastric and pituitary cancers correlates with reduced Rprm expression, reversible via demethylating agents .

Comparative Analysis of Recombinant Rprm Products

ProductSourceHostTagsPurityApplications
RTEB1104 Rat RprmE. coliNoneN/AELISA detection
ABIN3011466 Rat RprmE. coliHis-tag>95%WB, SDS-PAGE, IP
Cloud-Clone RPRM Rat RprmE. coliHis-tag, MBP-tag>97%Positive control, immunogen

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Rprm; Protein reprimo
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MNSVLGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
Uniprot No.

Target Background

Function
Reprimo (RPRM) may play a role in regulating p53-dependent G2 arrest of the cell cycle. It potentially induces cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex.
Database Links
Protein Families
Reprimo family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.

Q&A

What is Protein Reprimo (RPRM) and what are its primary cellular functions?

Reprimo (RPRM) is a tumor suppressor gene that plays a vital role in DNA damage repair and cell cycle regulation. The protein is involved in the regulation of mitotic cell cycle and acts upstream of cell cycle regulatory pathways . RPRM can be induced by DNA damage and plays an important role in DNA damage repair through its negative regulatory effect on the ataxia–telangiectasia-mutated (ATM) protein kinase . It is primarily active in the cytoplasm and is predicted to be an integral component of cell membranes . RPRM is variably expressed in different tissues, with particularly abundant expression in the brain . Its tumor suppressor function is crucial in preventing the development of various malignant tumors, including gastric cancer and pituitary tumors .

How is RPRM expression regulated in normal and pathological conditions?

RPRM expression is significantly regulated by DNA methylation, with hypermethylation of the RPRM gene promoter region correlating with decreased gene expression in various cancer tissues and cell lines. Studies have demonstrated hypermethylation in gastric cancer tissues (75%, 45/60), plasma samples (86.3%, 44/51), and cancer cell lines (75%, 3/4) . This hypermethylation-induced reduction in RPRM expression can be reversed using demethylating agents such as zebularine, or by inhibiting DNA methyltransferases through RNA interference and CRISPR/Cas9-mediated gene knockout . Under normal conditions, RPRM expression is induced by DNA damage, allowing it to participate in DNA damage repair processes .

What are the key structural characteristics of rat RPRM protein that researchers should be aware of?

Rat RPRM is structurally similar to human RPRM, containing critical domains necessary for its tumor suppressor function. While the search results don't provide specific structural details for rat RPRM, the recombinant protein can be produced with various tags to facilitate isolation and identification, such as polyhistidine tags for affinity purification . The protein is predicted to be an integral component of membranes, which has implications for its purification and experimental application . When designing experiments with recombinant rat RPRM, researchers should consider the presence of any fusion tags and their potential impact on protein folding and activity.

What expression systems are optimal for producing functional recombinant rat RPRM protein?

Multiple expression systems can be utilized for producing recombinant rat RPRM protein, each with distinct advantages:

  • E. coli expression system: Offers the best yields and shorter turnaround times for recombinant RPRM production . This bacterial system is particularly suitable when large quantities of protein are required and when post-translational modifications are not critical for the intended application.

  • Yeast expression system: Also provides good yields and relatively short production times . This system offers some post-translational modifications that might be important for certain applications.

  • Insect cell expression with baculovirus: Provides many of the post-translational modifications necessary for correct protein folding, which may be essential for maintaining RPRM's activity in certain experimental contexts .

  • Mammalian cell expression: Offers the most comprehensive post-translational modifications, potentially preserving the protein's native activity . This system is recommended when studying RPRM in contexts where its physiological activity is crucial.

The choice of expression system should be guided by the specific research requirements, including needed protein quantity, purity, post-translational modifications, and intended experimental application.

What purification strategies yield the highest purity and functional activity for recombinant rat RPRM?

Affinity chromatography represents the most efficient purification strategy for recombinant rat RPRM, particularly when the protein is expressed with affinity tags such as polyhistidine (His-tag). Drawing from analogous recombinant protein purification techniques, the following multi-step purification protocol is recommended:

  • Initial affinity chromatography: Using nickel or cobalt resins for His-tagged RPRM to achieve primary purification from cell lysates .

  • Size exclusion chromatography: To separate the target protein from aggregates and smaller contaminating proteins.

  • Ion exchange chromatography: As a polishing step to remove remaining impurities based on charge differences.

Identity confirmation should be performed using gel electrophoresis and Western blot analysis with anti-RPRM antibodies . This purification strategy typically yields protein with high purity (>95%) while maintaining functional activity. For applications requiring tag removal, specific protease cleavage sites can be incorporated between the tag and RPRM during the cloning process.

How can researchers verify the functional integrity of purified recombinant rat RPRM?

Verifying functional integrity of purified recombinant rat RPRM requires multiple complementary approaches:

  • Structural integrity assessment:

    • SDS-PAGE to confirm correct molecular weight (approximately 24 kDa for fusion proteins)

    • Circular dichroism spectroscopy to evaluate secondary structure

    • Dynamic light scattering to assess homogeneity and detect aggregation

  • Functional assays:

    • DNA damage repair assays using γ-H2AX as a marker

    • Cell cycle analysis in appropriate cell lines

    • Binding assays with known interaction partners (e.g., ATM protein kinase)

  • Cellular response verification:

    • Applying purified RPRM to cell cultures and measuring expected cellular responses

    • Evaluating effects on microglia and neurons if studying neurological applications

    • Observing mitogenic effects if investigating proliferative properties

  • Antibody recognition:

    • Western blot analysis using antibodies raised against native RPRM to confirm epitope preservation

These validation methods ensure that the recombinant protein maintains both structural integrity and functional activity comparable to the endogenous protein.

How does RPRM knockout affect radiation-induced brain injury models?

RPRM knockout significantly alleviates radiation-induced brain injury (RIBI) through multiple mechanisms. In RPRM knockout (KO) mouse models exposed to whole-brain irradiation (WBI), researchers observed:

  • Reduced DNA damage: RPRM knockout mice showed significantly lower levels of γ-H2AX (a marker for DNA damage) in the hippocampus compared to wild-type mice after 10 Gy WBI .

  • Decreased hippocampal apoptosis: Less severe neuronal damage and reduced apoptotic cell death were observed in RPRM KO mice following radiation exposure .

  • Attenuated neuroinflammation: RPRM deletion dramatically mitigated the neuroinflammatory response and microglial activation induced by WBI .

  • Preservation of neurogenesis: Long-term studies showed that RPRM knockout attenuated the WBI-induced inhibition of neurogenesis .

  • Improved cognitive outcomes: RPRM KO mice demonstrated better cognitive function after radiation compared to wild-type mice .

The protective effects of RPRM deletion were observed in both microglia and neurons. In RPRM KO mice, the number of Iba-1+/γH2AX+ cells (indicating damaged microglia) was approximately half that of wild-type mice, and the γH2AX fluorescence intensity in neuronal cells was reduced by 19% . These findings suggest that RPRM may be a potential therapeutic target for preventing or treating radiation-induced brain injury.

What is the relationship between RPRM methylation and gastric cancer development?

RPRM methylation plays a significant role in gastric cancer development, with research revealing a strong correlation between RPRM gene hypermethylation and reduced expression in gastric cancer tissues. The key findings include:

  • High prevalence of hypermethylation: RPRM gene promoter region is hypermethylated in 75% (45/60) of gastric cancer tissues and 86.3% (44/51) of plasma samples from gastric cancer patients .

  • Expression correlation: This hypermethylation directly correlates with decreased RPRM gene expression at both mRNA and protein levels as confirmed by quantitative reverse transcription-PCR and Western blotting .

  • Reversibility: The hypermethylation-induced reduction of RPRM can be recovered by treating with zebularine, a demethylating agent, or by inhibiting DNA methyltransferases through RNA interference and CRISPR/Cas9-mediated gene knockout .

  • Tumorigenesis promotion: Studies with RPRM gene-knockout cells demonstrate that loss of RPRM can promote tumorigenesis when these cells are inoculated in mice .

This relationship suggests that RPRM methylation status could serve as a biomarker for early gastric cancer detection, and strategies to restore RPRM expression could represent potential therapeutic approaches for gastric cancer treatment.

How can recombinant RPRM be utilized in potential therapeutic applications?

Recombinant RPRM holds significant potential for therapeutic applications based on its tumor suppressor functions and role in DNA damage repair. Potential therapeutic applications include:

  • Cancer therapy: As RPRM functions as a tumor suppressor, recombinant RPRM could be developed for targeted delivery to cancer cells with RPRM deficiency, particularly in gastric cancer and other malignancies where RPRM is frequently silenced through hypermethylation .

  • Radiation protection: Paradoxically, while RPRM deletion provides protection against radiation-induced brain injury, carefully controlled RPRM modulation might be useful in developing radioprotective agents for patients undergoing cranial radiotherapy .

  • Biomarker development: Recombinant RPRM can serve as a positive control in diagnostic assays for detecting RPRM methylation status in patient plasma samples, potentially enabling early cancer detection .

  • Experimental models: Utilizing recombinant RPRM in cellular and animal models can help elucidate its precise molecular mechanisms of action, potentially revealing new therapeutic targets within its associated signaling pathways .

  • Combination therapies: Recombinant RPRM could be used in combination with demethylating agents to restore RPRM function in cancers characterized by RPRM hypermethylation .

Each of these applications requires careful optimization of recombinant RPRM production, purification, and delivery methods to ensure therapeutic efficacy while minimizing potential side effects.

What are the optimal conditions for using recombinant rat RPRM in in vitro cell culture experiments?

When designing in vitro experiments with recombinant rat RPRM, researchers should consider the following optimal conditions:

  • Protein concentration range: Based on similar recombinant proteins, effective concentrations typically range from 10-100 ng/mL for observing cellular responses. Dose-response experiments should be conducted to determine the optimal concentration for specific cell types and experimental endpoints .

  • Buffer composition: Physiological buffers (PBS with pH 7.2-7.4) supplemented with stabilizing agents such as 0.1% BSA are recommended for maintaining protein stability during experiments.

  • Cell types: When studying neurological applications, primary neurons and microglial cells are particularly relevant as RPRM shows significant effects on these cell types . For cancer-related studies, gastric cancer cell lines are appropriate models given RPRM's established role in gastric cancer pathogenesis .

  • Exposure time: Short-term exposures (6-24 hours) are suitable for evaluating immediate effects on DNA damage and apoptosis, while longer exposures (48-72 hours) may be necessary for observing changes in gene expression and cell cycle regulation .

  • Experimental controls: Include both positive controls (known inducers of the pathways being studied) and negative controls (buffer-only treatments) alongside inactive protein variants to distinguish specific from non-specific effects.

  • Verification methods: Employ western blotting, immunofluorescence, or flow cytometry to confirm protein uptake or surface binding depending on the hypothesized mechanism of action.

These optimized conditions ensure reproducible and physiologically relevant results when studying recombinant rat RPRM in cellular models.

What experimental approaches are most effective for studying RPRM's role in DNA damage repair?

To effectively study RPRM's role in DNA damage repair, researchers should employ a multi-faceted experimental approach:

  • γ-H2AX assays: Quantify DNA double-strand breaks by measuring γ-H2AX levels through:

    • Immunofluorescence to visualize nuclear foci

    • Flow cytometry for population-level quantification

    • Western blotting for total protein level assessment

  • Comet assay: Evaluate DNA damage at the single-cell level by measuring DNA migration patterns under electrophoresis.

  • ATM pathway analysis: Given RPRM's negative regulatory effect on ATM protein kinase, assess:

    • ATM phosphorylation status

    • Phosphorylation of ATM substrates (e.g., p53, CHK2)

  • Radiation models: Employ controlled radiation exposure (e.g., 10 Gy whole-brain irradiation for in vivo studies) to induce DNA damage in:

    • RPRM knockout vs. wild-type animals

    • Cell lines with RPRM knockdown or overexpression

  • Time-course experiments: Monitor DNA damage repair kinetics at multiple timepoints post-radiation (e.g., 6 hours, 24 hours, 72 hours) to capture both immediate and delayed responses .

  • Cell-specific analysis: Distinguish effects between different cell types (e.g., neurons vs. microglia) using co-staining with cell-type-specific markers such as NeuN (neurons) and Iba-1 (microglia) .

  • Rescue experiments: Reintroduce recombinant RPRM into knockout models to confirm specificity of observed phenotypes.

These approaches collectively provide comprehensive insights into RPRM's mechanistic role in DNA damage repair pathways.

What are the key considerations when designing RPRM knockout models for cancer research?

When designing RPRM knockout models for cancer research, researchers should address these critical considerations:

  • Knockout strategy selection:

    • CRISPR/Cas9 gene editing offers precise targeting of the RPRM gene with minimal off-target effects

    • Consider conditional knockout systems to control the timing of RPRM deletion, especially if complete knockout affects development

  • Model validation requirements:

    • Confirm knockout at DNA level (sequencing)

    • Verify absence of protein expression (Western blot)

    • Assess functional consequences (altered DNA damage response)

  • Control selection:

    • Include appropriate wild-type controls from the same genetic background

    • Consider heterozygous knockouts to study gene dosage effects

    • Generate rescue models reintroducing RPRM to confirm phenotype specificity

  • Cancer model compatibility:

    • For gastric cancer: Consider RPRM knockout in conjunction with Helicobacter pylori infection models

    • For other cancers: Combine RPRM knockout with tissue-specific carcinogenic challenges

  • Experimental endpoints:

    • Tumorigenesis parameters (tumor incidence, growth rate, metastasis)

    • Molecular analyses (DNA methylation patterns, ATM pathway signaling)

    • Cell cycle regulation assessment

  • Translational considerations:

    • Include analyses of patient-derived xenografts to validate findings in human cancers

    • Design experiments to test therapeutic interventions targeting the consequences of RPRM loss

  • Ethical considerations:

    • Implement humane endpoints for animal studies

    • Apply the 3Rs principle (Replacement, Reduction, Refinement) in experimental design

Careful attention to these considerations ensures development of robust RPRM knockout models that accurately reflect the role of this tumor suppressor in cancer biology.

How should researchers interpret contradictory findings regarding RPRM's role in radiation sensitivity?

Researchers face an apparent paradox in RPRM's role in radiation sensitivity: while RPRM functions as a tumor suppressor, its deletion unexpectedly confers radioprotection in brain tissue. When interpreting these seemingly contradictory findings, consider the following analytical framework:

  • Tissue-specific effects: RPRM's function may vary significantly between tissues. While abundant in brain tissue , its deletion provides radioprotection specifically in neural cells, whereas its tumor suppressor role may predominate in other tissues like the gastrointestinal tract .

  • Differential cellular mechanisms: The radioprotective effect in brain tissue operates through reduced DNA damage and apoptosis in neurons and microglia , whereas tumor suppression involves cell cycle regulation. These represent distinct cellular pathways that may respond differently to RPRM.

  • Context-dependent outcomes: RPRM's interaction with the ATM pathway suggests its effects may depend on cellular context, particularly the activation state of DNA damage response pathways .

  • Temporal considerations: Acute radioprotection (observed in brain injury models) versus long-term tumor suppression may represent different temporal aspects of RPRM function.

  • Developmental factors: RPRM's role may change throughout development and aging, contributing to context-specific outcomes.

This framework helps reconcile the dual role of RPRM as both a tumor suppressor and a mediator of radiation sensitivity. Rather than viewing these findings as contradictory, researchers should conceptualize RPRM as having context-dependent functions within complex cellular signaling networks.

What statistical approaches are recommended for analyzing RPRM expression and methylation data?

For robust analysis of RPRM expression and methylation data, researchers should employ these statistical approaches:

  • Methylation analysis:

    • Bisulfite sequencing data requires specialized methylation analysis software to determine CpG methylation percentages

    • Apply logistic regression models to identify associations between methylation status and clinical variables

    • Utilize ROC curve analysis to evaluate methylation as a diagnostic biomarker, as demonstrated in studies showing high methylation rates in gastric cancer (75% in tissues, 86.3% in plasma)

  • Expression correlation:

    • Calculate Pearson or Spearman correlation coefficients between methylation levels and RPRM expression

    • Apply linear regression models to quantify the relationship between methylation percentage and expression levels

    • Use multivariate analysis to control for confounding factors

  • Comparative analyses:

    • For comparing RPRM expression or methylation between groups (e.g., cancer vs. normal tissues), use:

      • Student's t-test for normally distributed data

      • Mann-Whitney U test for non-parametric data

      • ANOVA with post-hoc tests for multiple group comparisons

  • Survival analysis:

    • Kaplan-Meier curves with log-rank tests to assess prognostic significance

    • Cox proportional hazards models to evaluate RPRM as an independent prognostic factor

  • Experimental data analysis:

    • For knockout studies, use appropriate statistical tests with correction for multiple comparisons

    • Calculate effect sizes and confidence intervals to assess biological significance beyond statistical significance

    • Consider hierarchical models for nested experimental designs (e.g., multiple measurements from the same animal)

These statistical approaches ensure rigorous interpretation of RPRM data while accounting for biological variability and experimental design complexities.

How can researchers effectively integrate RPRM functional data across different experimental models?

Integrating RPRM functional data across diverse experimental models requires a systematic approach to synthesize findings from in vitro, in vivo, and clinical studies:

This structured approach enables researchers to build a comprehensive understanding of RPRM function that transcends the limitations of individual experimental systems, ultimately facilitating translation to clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.