Recombinant Rat Protein-S-isoprenylcysteine O-methyltransferase (Icmt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us beforehand as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Before opening the vial, it is recommended to briefly centrifuge it to bring the contents to the bottom. Please reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development if possible.
Synonyms
Icmt; Protein-S-isoprenylcysteine O-methyltransferase; Farnesyl cysteine carboxyl methyltransferase; FCMT; Isoprenylcysteine carboxylmethyltransferase; Prenylated protein carboxyl methyltransferase; PPMT; Prenylcysteine carboxyl methyltransferase; pcCMT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Icmt
Target Protein Sequence
ALLLLLYRPPHYQIAIRACFLGFVFGCGVLLSFSQSSWNHFGWYVCSLSLFHYSEYLVTT VNNPKSLSLDSFLLNHSLEYTVAALSSWIEFTLENIFWPELKQITWLSAAGLLMVIFGEC LRKVAMFTAGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWFYWSIGTQVMLCNPIC GVVYALTVWRFFRDRTEEEEISLIHFFGEEYLDYKKRVPTGLPFIKGVKVGL
Uniprot No.

Target Background

Function
Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues.
Database Links
Protein Families
Class VI-like SAM-binding methyltransferase superfamily, Isoprenylcysteine carboxyl methyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Icmt in cellular pathways?

Icmt catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues in target proteins. This enzyme belongs to the isoprenylcysteine O-methyltransferase family and plays a critical role in the final step of protein prenylation. In the methylation reaction, Icmt transfers a methyl group from S-adenosyl-L-methionine (AdoMet) to the C-terminal isoprenylated cysteine residue of CaaX proteins, generating a C-terminal prenylcysteine methyl ester on the protein . This modification is essential for proper membrane localization and function of many signaling proteins, including members of the Ras superfamily of small GTPases.

Where is Icmt localized within cellular structures?

Icmt is predominantly an integral membrane protein localized to the endoplasmic reticulum (ER). Its membrane-bound nature is essential for its function in modifying newly synthesized proteins that have undergone prenylation. The enzyme contains multiple membrane-spanning domains that anchor it within the ER membrane, with its active site positioned to interact with prenylated substrate proteins . This strategic localization places Icmt in an optimal position to modify proteins as they proceed through the secretory pathway.

What are the common methods for measuring Icmt activity in laboratory settings?

Several methodological approaches can be employed to assess Icmt activity in research settings. One widely used approach involves enzyme-linked immunosorbent assay (ELISA)-based methods that can quantitatively measure Icmt levels and activity . Another approach utilizes small molecule substrates such as biotin-S-farnesyl-L-cysteine (BFC), which facilitates kinetic analysis of the enzyme by allowing for easier product separation and detection .

For activity assays, researchers typically measure the transfer of radioactively labeled methyl groups from [³H]AdoMet or [¹⁴C]AdoMet to prenylated substrate proteins or synthetic peptides. The methylated products can then be separated by various chromatographic techniques and quantified by scintillation counting or other detection methods. When designing these assays, it's critical to maintain appropriate enzyme concentrations and reaction conditions to ensure linearity and reproducibility of results.

What is the kinetic mechanism of Icmt and how does this inform inhibitor design?

Kinetic analysis of recombinant human Icmt has revealed that the enzyme follows an ordered sequential mechanism, wherein AdoMet binds first to the enzyme, followed by binding of the prenylated substrate. After the methylation reaction occurs, the methylated product is released first, followed by S-adenosylhomocysteine (AdoHcy) .

This ordered binding mechanism was established through dead-end competitive inhibitor studies using S-farnesylthioacetic acid (FTA). The inhibition by FTA was competitive with respect to the substrate BFC and uncompetitive with respect to AdoMet, confirming the ordered sequential mechanism with AdoMet binding first . Understanding this kinetic mechanism provides crucial insights for the design of specific inhibitors targeting Icmt.

For example, compounds designed to compete with AdoMet binding would need to interact with the free enzyme, while compounds designed to compete with the prenylated substrate would need to interact with the enzyme-AdoMet complex. This mechanistic understanding allows for more rational approaches to developing potential therapeutic agents targeting Icmt activity.

How do researchers address contradictions in Icmt experimental data across different model systems?

When encountering contradictory data regarding Icmt function or activity across different experimental systems, researchers should consider several methodological approaches to resolve these inconsistencies:

  • Systematic comparison of experimental conditions, including buffer compositions, enzyme preparations, substrate concentrations, and detection methods.

  • Analysis of species-specific differences in Icmt sequence, structure, and post-translational modifications that might affect enzymatic properties.

  • Evaluation of contextual factors such as the presence of cellular cofactors, regulatory proteins, or membrane environments that could modulate Icmt activity.

  • Implementation of multiple complementary techniques to validate findings, such as combining in vitro biochemical assays with cellular and in vivo approaches.

  • Consideration of conditional contradictions, where apparent discrepancies might be explained by specific experimental conditions or biological contexts .

Recent advances in modeling contradiction detection suggest that comparing information across distinct experimental systems is often more effective than analyzing internal consistency within a single experimental setup . Therefore, researchers should explicitly test hypotheses across multiple systems and conditions to resolve contradictions rather than relying on data from a single experimental paradigm.

What role does Icmt play in modulating cellular signaling pathways through RhoA and Rac1?

Icmt plays a significant role in modulating cellular signaling pathways through its effects on small GTPases like RhoA and Rac1. Research has demonstrated that Icmt-mediated carboxyl methylation of RhoA affects its subcellular localization and activation state, which in turn influences downstream signaling events.

In endothelial cells, Icmt modulates monolayer permeability by altering RhoA carboxyl methylation and activation. Inhibition of Icmt with adenosine plus homocysteine or N-acetyl-S-geranylgeranyl-l-cysteine decreased RhoA carboxyl methylation, RhoA activity, and endothelial monolayer permeability . Conversely, overexpression of Icmt increased RhoA carboxyl methylation, membrane-bound RhoA, and RhoA activity, resulting in diminished VE-cadherin and β-catenin at intercellular junctions, intercellular gap formation, and enhanced monolayer permeability .

What are the optimal conditions for expressing and purifying recombinant rat Icmt?

Expressing and purifying recombinant rat Icmt requires careful attention to several key parameters due to its nature as an integral membrane protein. Based on established protocols for similar methyltransferases, the following methodological approach is recommended:

Expression System Selection:

  • Insect cell expression systems (such as Sf9 cells) have proven effective for expressing recombinant Icmt with proper folding and activity .

  • Mammalian expression systems may be preferred when post-translational modifications are critical for the research question.

  • Bacterial expression systems typically yield lower functional protein due to challenges with membrane protein folding but may be sufficient for some applications when coupled with optimization strategies.

Purification Strategy:

  • Solubilization of membrane-bound Icmt using appropriate detergents (e.g., CHAPS, DDM, or Triton X-100) at concentrations that maintain enzyme activity.

  • Affinity chromatography using engineered tags (His-tag, FLAG-tag) as the initial purification step.

  • Size exclusion chromatography to remove aggregates and further enhance purity.

  • Activity-based verification at each purification step to ensure retention of enzymatic function.

Optimization of buffer conditions is critical, with typical buffers containing 20-50 mM HEPES or Tris (pH 7.5-8.0), 100-300 mM NaCl, 5-10% glycerol, and appropriate detergent concentrations above the critical micelle concentration to maintain protein solubility and activity.

How can researchers develop and validate novel small molecule substrates for Icmt kinetic studies?

Developing novel small molecule substrates for Icmt kinetic studies requires a systematic approach that balances substrate specificity with practical assay considerations. The development of biotin-S-farnesyl-L-cysteine (BFC) provides an instructive example of this process :

Design Principles:

  • Incorporate the minimal structural elements required for recognition by Icmt (the isoprenylated cysteine moiety).

  • Include a tag or modification (such as biotin) that facilitates easy separation and quantification of reaction products.

  • Ensure the modification does not interfere with substrate binding or catalysis.

Synthesis and Validation Workflow:

  • Chemical synthesis of candidate molecules (e.g., coupling biotin to the free amino group of S-farnesylcysteine) .

  • Purification by precipitation or reverse-phase chromatography.

  • Structural validation using mass spectrometry and NMR.

  • Initial activity screening to confirm substrate recognition by Icmt.

  • Determination of kinetic parameters (Km, Vmax) and comparison with established substrates.

  • Validation in enzymatic assays under varying conditions to establish robustness.

After developing a novel substrate, comprehensive validation should include competitive assays with known substrates, inhibitor studies, and correlation of results with alternative assay methods to ensure that the novel substrate accurately reflects the enzyme's natural activity.

What experimental approaches can differentiate direct effects of Icmt inhibition from indirect cellular responses?

Differentiating direct effects of Icmt inhibition from indirect cellular responses requires a multi-faceted experimental approach:

Complementary Inhibition Strategies:

  • Pharmacological inhibition using specific Icmt inhibitors (e.g., adenosine plus homocysteine or N-acetyl-S-geranylgeranyl-l-cysteine) .

  • Genetic knockdown/knockout approaches (siRNA, CRISPR-Cas9) targeting Icmt expression.

  • Expression of dominant-negative Icmt variants.

Temporal Resolution Analysis:

  • Time-course experiments to distinguish immediate effects (likely direct) from delayed responses (potentially indirect).

  • Pulse-chase experiments to track the methylation status of specific substrates over time following inhibition.

Substrate-Specific Evaluation:

  • Monitor methylation status of known Icmt substrates (e.g., RhoA) using specific antibodies or mass spectrometry-based approaches.

  • Correlate changes in substrate methylation with functional outcomes.

Rescue Experiments:

  • Expression of methylation-mimicking variants of key substrates to determine if they rescue phenotypes observed after Icmt inhibition.

  • Complementation with wild-type or mutant forms of Icmt to establish specificity of observed effects.

A particularly informative approach is to combine these strategies while monitoring specific downstream pathways. For example, in studies examining Icmt's role in endothelial permeability, researchers demonstrated that the effects of Icmt overexpression were blunted by adenosine plus homocysteine (pharmacological inhibition) and by inhibition of RhoA, but not by inhibition of Rac1 . This combination of approaches provided strong evidence for a direct effect of Icmt on RhoA-mediated signaling in this context.

How does Icmt function differ between endothelial cells and pancreatic beta-cells?

Icmt exhibits context-dependent functions across different cell types, with notable differences between endothelial cells and pancreatic beta-cells. In endothelial cells, Icmt primarily regulates barrier function through its effects on RhoA methylation and activation. Inhibition of Icmt decreases RhoA carboxyl methylation and activity, consequently reducing endothelial monolayer permeability . Overexpression of Icmt in endothelial cells increases membrane-bound RhoA and disrupts intercellular junctions, leading to gap formation and enhanced permeability .

In contrast, in pancreatic beta-cells, Icmt plays a crucial role in regulating glucose-induced Rac1 activation, generation of reactive oxygen species, and insulin secretion . This suggests that Icmt modulates different small GTPases depending on the cellular context, targeting RhoA in endothelial cells and Rac1 in pancreatic beta-cells.

These cell type-specific functions highlight the importance of considering cellular context when investigating Icmt function and suggest that targeting Icmt for therapeutic purposes might have different effects depending on the tissue involved. Researchers should therefore carefully select cellular models that appropriately represent the physiological context relevant to their specific research questions.

What is the relationship between Icmt activity and disease pathophysiology?

Icmt activity has been implicated in several pathophysiological processes, primarily through its effects on the localization and function of small GTPases and other signaling proteins. Understanding these relationships provides valuable insights for both basic research and therapeutic development.

In vascular pathophysiology, Icmt's role in modulating endothelial barrier function through RhoA methylation and activation suggests potential involvement in conditions characterized by abnormal vascular permeability, such as inflammatory disorders, sepsis, and certain cardiovascular diseases . Alterations in Icmt expression or activity could contribute to the endothelial dysfunction observed in these conditions.

In metabolic disorders, Icmt's role in regulating glucose-induced Rac1 activation and insulin secretion in pancreatic beta-cells suggests potential involvement in diabetes pathophysiology . Dysregulation of Icmt activity could affect insulin secretion and contribute to impaired glucose homeostasis.

When investigating the relationship between Icmt and disease states, researchers should consider both direct effects on enzymatic activity and potential alterations in Icmt expression levels. Additionally, the substrate specificity of Icmt in different cellular contexts may result in disease-specific manifestations of Icmt dysfunction. This complexity necessitates careful experimental design that incorporates both in vitro biochemical approaches and appropriate disease models to elucidate the precise role of Icmt in specific pathological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.