Recombinant Rat Protein tweety homolog 1 (Ttyh1)

Shipped with Ice Packs
In Stock

Description

Definition and Characteristics of Recombinant Rat Protein tweety homolog 1 (Ttyh1)

Recombinant Rat Protein tweety homolog 1 (Ttyh1) is a synthetic, full-length protein encoded by the Ttyh1 gene in Rattus norvegicus (Norway rat). It belongs to the tweety family of proteins, characterized as calcium-independent, volume-regulated anion channels (VRAC-swell) critical for cellular osmotic regulation . The recombinant form is typically expressed in E. coli with an N-terminal His-tag for purification and stability .

ParameterValue
UniProt IDP0C5X8
Amino Acid Length450 aa (rat)
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in deionized water; glycerol recommended for long-term storage

Functional Roles in Biological Systems

Ttyh1 exhibits diverse roles in neural and cellular physiology:

FunctionMechanismRelevance
Neural Stem Cell RegulationMaintains quiescence via Ca²⁺/NFAT signaling; knockout accelerates neurogenesis in adult mice but depletes stem cell pools in aging .Critical for brain repair and neurogenesis.
OsmoregulationVRAC-swell activity regulates cellular volume by effluxing anions .Prevents osmotic stress-induced cell damage.
Cell MorphologyInduces filopodia formation in neurons and motile cells, linked to microtubule polarization .Involved in axonal guidance and process formation.

Research Findings and Molecular Insights

Recent studies highlight Ttyh1’s complex regulatory mechanisms:

Transcriptional Regulation

The rat Ttyh1 promoter (592 bp) contains binding sites for Ascl1, Sp1, and E2F3 transcription factors. Functional assays demonstrate:

  • Ascl1 Overexpression: Increases Ttyh1 promoter activity by 1.6-fold, suggesting a role in neuronal differentiation .

  • Sp1 Deletion: Reduces promoter activity in E. coli-expressed constructs, indicating Sp1’s role in basal expression .

Transcription FactorBinding SiteEffect on Ttyh1 Expression
Ascl1−175 to −163 bpEnhances transcription
Sp1−142 to −126 bpMaintains basal activity
E2F3−375 to −360 bpNo significant regulatory effect

Calcium Signaling and Neurogenesis

Ttyh1 knockout mice exhibit:

  • Enhanced Spatial Memory: Linked to increased neurogenesis in adult hippocampal regions .

  • Accelerated Stem Cell Exhaustion: Aged mice show reduced neurogenic capacity due to premature activation of quiescent neural stem cells (NSCs) .

Applications in Research and Biotechnology

Recombinant Ttyh1 is utilized in:

  • Neuroscience: Studying NSC quiescence, neurogenesis, and spatial memory .

  • Cancer Research: Investigating glioma progression and astrocyte activation .

  • Drug Discovery: Targeting Ttyh1-mediated ion flux in pathological conditions .

Technical Considerations for Experimental Use

ParameterRecommendation
Storage−20°C/−80°C; aliquot to avoid freeze-thaw cycles.
ReconstitutionUse sterile water with 5–50% glycerol for long-term stability.
Purity ValidationConfirm via SDS-PAGE or Western blotting with anti-His tag antibodies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, we recommend adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ttyh1; Protein tweety homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ttyh1
Target Protein Sequence
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPRDQEYQQALLLVAALAGLGLGLSLI FIAVYLIRFCCCRPPEPPGAKSPPPGGGCVTWSCIAALLVGCAGIGIGFYGNSETSDGVS QLSSALQHANHTLSTIDDLVLETVERLGEAVRTELTTLEEVLSERVELVAATRGARRQAE AAAQHLQGLAFWQGVSLSPVQVAEDVTFVEEYRWLAYVLLLLLVLLVCLFTLLGLAKQSK WLVVVMTAMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDTYVLNLTQEETGISSDILNYY FLCNQAVSNPFQQRLTLSQRALASIHSQLQGLEREASPQFPAAQKPLLSLEETLNVTERS FHQLVALLHCRSLHKDYGSALRGLCEDALEGLLFLMLFSLLSAGALATTLCSLPRAWALF PPSDDYDDTDDDDPFNPQESKRFVQWQSSI
Uniprot No.

Target Background

Function
This protein is likely a chloride channel and may play a role in cell adhesion.
Gene References Into Functions
  1. Research suggests that Ttyh1 is involved in process formation, cell adhesion, and potentially acts as a transmembrane receptor. PMID: 17116230
Database Links
Protein Families
Tweety family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Tweety Homolog 1 (Ttyh1) and what are its primary functions?

Tweety Homolog 1 (Ttyh1) is a member of the Tweety family of proteins, functioning primarily as a calcium-independent, volume-sensitive large conductance chloride channel . Ttyh1 is abundantly expressed in neurons in the healthy brain and shows induced expression under pathological conditions . The protein has a five-transmembrane topology with a relatively minimal extracellular domain compared to its distant homologs, the prominins .

In terms of functional characteristics, Ttyh1 plays multiple significant roles in the nervous system. It has been implicated in the regulation of primary neuron morphology in hippocampal neurons in vitro . Additionally, Ttyh1 is critically involved in the maintenance of neural stem cell (NSC) properties, primarily through its interaction with the Notch signaling pathway, which is crucial for proper neural development . Research has also demonstrated that Ttyh1 induces formation of extracellular vesicles (EVs) in cultured mammalian cells, suggesting a role in cellular communication .

Three distinct transcript variants encoding different isoforms have been identified for the Ttyh1 gene, indicating potentially diverse functions based on alternative splicing .

What is the expression pattern of Ttyh1 in the central nervous system?

Ttyh1 exhibits a pronounced neural expression pattern, being predominantly expressed in neural tissues throughout development and in the adult brain . In the healthy adult brain, Ttyh1 is abundantly expressed in neurons . Its expression is particularly notable in neural stem cell populations in both the subventricular zone (SVZ) and the subgranular zone (SGZ) of the hippocampus, the two primary neurogenic niches in the mammalian brain .

During embryonic development, Ttyh1 expression is observed in the ventricular zone (VZ) and subventricular zone, regions housing neural stem and progenitor cells . This spatial distribution aligns with its functional role in maintaining neural stem cell properties. Experimental evidence demonstrates that Ttyh1 overexpression significantly increases the presence of cells in the VZ/SVZ regions, with these cells expressing the neural stem cell marker Sox2 .

Notably, Ttyh1 expression can be induced under pathological conditions, suggesting its potential involvement in neural response to injury or disease . This dynamic expression pattern makes Ttyh1 a protein of interest in both developmental neurobiology and neuropathological research.

How can the rat Ttyh1 gene be cloned for recombinant protein expression?

The cloning of rat Ttyh1 gene for recombinant protein expression requires a methodical approach based on established molecular biology techniques. Researchers have successfully cloned the rat Ttyh1 promoter sequence (592 bp) using the following methodology :

First, identify the Ttyh1 coding sequence from rat genomic databases and design specific primers that flank the target sequence, including appropriate restriction enzyme sites for subsequent cloning steps. RNA extraction from rat brain tissue (preferably hippocampal) followed by reverse transcription to generate cDNA provides the template for PCR amplification of the Ttyh1 sequence .

For expression vector construction, researchers typically use vectors like pGL4.10[luc2] (as reported in the literature) where the Ttyh1 sequence can be fused upstream of a reporter gene such as luciferase . This construct design allows for functional analysis of gene expression and regulation. The PCR-amplified Ttyh1 sequence should be purified, digested with appropriate restriction enzymes, and ligated into the similarly digested expression vector.

Verification of successful cloning requires sequence analysis to confirm the integrity of the cloned Ttyh1 sequence. For protein expression, the validated construct can be transfected into mammalian cell lines (HEK293 cells are commonly used) or introduced into bacterial expression systems depending on the research objectives .

For studies focusing on transcriptional regulation, deletion constructs targeting specific transcription factor binding sites (such as Sp1, E2F3, and Ascl1) can be designed to analyze their functional significance in Ttyh1 expression .

What are the optimal expression systems for producing functional recombinant rat Ttyh1 protein?

The production of functional recombinant rat Ttyh1 protein requires careful consideration of expression systems based on the protein's characteristics and the intended experimental applications. Several expression systems have been documented in the literature:

Mammalian expression systems are generally preferred for Ttyh1 production due to the protein's transmembrane nature and need for proper post-translational modifications. HEK293 cells have been successfully employed for Ttyh1 expression, particularly when studying its function in extracellular vesicle formation and membrane dynamics . These cells provide an environment that supports proper protein folding and trafficking of transmembrane proteins like Ttyh1.

For studies examining Ttyh1's role in neural contexts, expression in primary neural stem cells or neuronal cultures can provide a more physiologically relevant system. Neurosphere cultures from embryonic neural tissue (typically E14.5) have been used to study Ttyh1 function in neural stem cell maintenance .

E. coli-based expression systems have also been used for certain applications, though these may be more suitable for producing specific domains or fragments rather than the full-length functional protein given Ttyh1's transmembrane nature . When using bacterial systems, fusion tags such as His, GST, or Fc can facilitate purification and potentially enhance solubility .

For optimal functional analysis, particularly when studying Ttyh1's ion channel properties or its role in membrane dynamics, expression systems that allow for proper membrane integration are essential. In such cases, mammalian cell systems with inducible expression constructs provide better control over expression levels, which can be critical when investigating transmembrane proteins that may cause cellular toxicity when overexpressed.

What experimental approaches are effective for studying Ttyh1's role in neural stem cell function?

Investigating Ttyh1's role in neural stem cell function requires a multi-faceted experimental approach combining in vitro and in vivo methodologies. Several effective strategies have been documented in the literature:

In vitro neurosphere assays represent a fundamental approach for assessing neural stem cell properties under Ttyh1 manipulation. Neural stem cells isolated from E14.5 embryonic mouse brains can be cultured as neurospheres after Ttyh1 overexpression or knockdown . Parameters such as neurosphere size, number, and self-renewal capacity (through secondary and tertiary neurosphere formation) provide quantitative measures of stemness.

In vivo analysis through in utero electroporation allows for targeted manipulation of Ttyh1 expression in the developing brain. This technique involves introducing expression constructs (overexpression vectors or shRNA knockdown constructs) into the lateral ventricles of embryonic brains followed by electrical pulses to facilitate DNA uptake by neural stem cells . Subsequent analysis of cell distribution patterns (VZ/SVZ localization), neural stem cell marker expression (Sox2), and differentiation marker expression provides insights into Ttyh1's function in neural stem cell maintenance.

Genetic approaches utilizing Ttyh1 knockout mice created through CRISPR/Cas9 gene editing allow for comprehensive analysis of Ttyh1's role in neural development . These models enable assessment of NSC proliferation through BrdU incorporation assays and examination of neuroblast formation through DCX immunostaining.

Molecular pathway analysis can be performed using co-expression studies combining Ttyh1 manipulation with Notch pathway components. For instance, co-expression of dominant-negative MAML1 (dnMAML1) or NICD with Ttyh1 has revealed its functional connection to Notch signaling . Similarly, γ-secretase activity assays following Ttyh1 manipulation help elucidate the molecular mechanisms underlying Ttyh1's effects on neural stem cells .

Behavioral testing of Ttyh1 knockout mice using paradigms like Morris water maze and open field tests provides functional outcomes of altered neurogenesis resulting from Ttyh1 absence .

How does Ttyh1 interact with the Notch signaling pathway in neural stem cells?

Ttyh1 exhibits a complex and significant interaction with the Notch signaling pathway in neural stem cells, functioning as both a target and a regulator of this critical developmental pathway. Experimental evidence demonstrates that Ttyh1 enhances neural stem cell properties specifically through upregulation of Notch signaling .

At the molecular level, Ttyh1 increases Notch signaling by enhancing γ-secretase activity, the enzyme complex responsible for cleaving the Notch receptor to release the Notch intracellular domain (NICD) . This enhancement occurs through a novel mechanism wherein Ttyh1 binds to and destabilizes Rer1, a negative regulator of γ-secretase activity located in the endoplasmic reticulum . The destabilization of Rer1 leads to increased γ-secretase activity, resulting in elevated NICD production and subsequent activation of Notch target genes.

This mechanism has been verified through multiple experimental approaches. In vitro studies show that Ttyh1 overexpression increases the expression of Notch target genes such as Hes1 and Hey1, while Ttyh1 knockdown reduces their expression . Additionally, the effects of Ttyh1 on neural stem cell maintenance can be abolished by inhibiting Notch signaling through co-expression of dominant-negative MAML1 (dnMAML1) or by direct inhibition of γ-secretase using dominant-negative Presenilin 1 (dnPS1) .

Interestingly, Ttyh1 is itself a direct transcriptional target of Notch, establishing a positive feedback loop where Notch activation increases Ttyh1 expression, and Ttyh1, in turn, enhances Notch signaling . This reciprocal relationship appears to be a unique function of Ttyh1 among Ttyh family members and suggests its critical role in maintaining appropriate levels of Notch activation during neural development.

What is the relationship between Ttyh1 and membrane dynamics in extracellular vesicle formation?

Ttyh1 plays a significant role in membrane dynamics, particularly in the formation and morphology of extracellular vesicles (EVs). Recent research has revealed that Ttyh1 induces the formation of EVs in cultured mammalian cells, with distinctive morphological characteristics compared to other EV-inducing proteins .

When overexpressed at the plasma membrane, Ttyh1 induces membrane tubulation, a phenomenon where the plasma membrane forms elongated tubular structures . This membrane-bending capability appears to be intrinsic to Ttyh1's function and is critical for its role in EV formation. Comparative analysis with Prominin 1 (Prom1), another EV-inducing protein, demonstrates that while both proteins induce physically similar EVs, Ttyh1-induced EVs exhibit significantly more tubulation than Prom1-induced EVs .

The molecular mechanism underlying Ttyh1's membrane-bending properties appears to involve protein concentration effects. Quantitative analysis reveals that Ttyh1 is present at approximately fivefold higher concentration in EV membranes compared to Prom1 . This higher protein density suggests that molecular crowding effects may contribute to the increased membrane bending observed in Ttyh1 EVs. Additionally, Ttyh1 EVs contain 8.8-fold more protein than Prom1 EVs from identical amounts of transfected cell media, while producing 5.6-fold more total EV membrane .

The distinctive feature of Ttyh1-induced EVs is their tubulated morphology, with a higher frequency of membrane bending compared to Prom1-induced EVs. Morphometric analysis reveals that Ttyh1 EVs have more irregular shapes with pronounced angular departures from circularity .

This function in membrane remodeling appears to be connected to Ttyh1's five-transmembrane topology, which allows it to integrate into the plasma membrane and potentially alter membrane curvature through mechanisms involving protein crowding and possibly interactions with membrane lipids, although the specific lipid interactions remain less characterized than for Prom1, which has a well-documented association with cholesterol .

How does Ttyh1 regulate neurogenesis in the adult brain?

Ttyh1 plays a crucial regulatory role in adult neurogenesis, primarily functioning as a maintenance factor for neural stem cell quiescence. Experimental evidence from Ttyh1 knockout mice demonstrates that Ttyh1 ablation leads to enhanced neural stem cell proliferation and neurogenesis in both major neurogenic niches of the adult brain - the subventricular zone (SVZ) and the subgranular zone (SGZ) of the hippocampus .

In the adult SVZ, Ttyh1 knockout results in a significant decrease in the number of quiescent type-B neural stem cells (identified as GFAP+/Sox2+ double-positive cells), accompanied by an increase in EGFR+ transit-amplifying progenitors (TAPs) . This shift in cell population dynamics indicates that Ttyh1 normally functions to maintain neural stem cells in a quiescent state, preventing their premature differentiation into more committed neural progenitors.

Quantitative analysis through BrdU incorporation assays in 6-8 week old mice shows significantly increased numbers of BrdU+ proliferating cells in both the SVZ (p = 0.0281) and SGZ (p = 0.0271) of Ttyh1 knockout mice compared to wild-type littermates . Similarly, immunofluorescence staining for DCX (doublecortin), a marker for neuroblasts, reveals increased neuroblast production in both neurogenic regions (p = 0.0325 in SVZ, p = 0.0204 in SGZ) following Ttyh1 ablation .

The functional consequence of this enhanced neurogenesis is evident in behavioral testing. Ttyh1 knockout mice demonstrate improved spatial learning and memory as assessed by the Morris water maze test, with significantly shorter latency in platform searching compared to wild-type controls . This behavioral enhancement aligns with the established connection between hippocampal neurogenesis and cognitive functions such as learning and memory.

Mechanistically, Ttyh1's regulation of adult neurogenesis appears to involve its role in the Notch signaling pathway, which is well-established as a critical regulator of neural stem cell maintenance. By promoting Notch signaling through enhanced γ-secretase activity, Ttyh1 contributes to the preservation of the quiescent neural stem cell pool in the adult brain .

What phenotypes are observed in Ttyh1 knockout models?

Ttyh1 knockout mouse models display distinct phenotypes that provide valuable insights into the protein's physiological functions, particularly in neural development and adult neurogenesis. These phenotypes manifest at cellular, molecular, and behavioral levels:

At the anatomical level, Ttyh1 knockout mice show comparable viability and gross brain morphology to wild-type littermates, with no obvious structural defects observed in neural stem cells during mid-embryonic stages . This suggests that Ttyh1 is not essential for basic brain formation but rather plays a more nuanced role in fine-tuning neural development and function.

The most prominent cellular phenotype in adult Ttyh1 knockout mice is enhanced neural stem cell proliferation and neurogenesis. Quantitative analysis reveals significant increases in BrdU+ proliferating cells in both the SVZ and SGZ neurogenic niches . Additionally, there is a marked increase in DCX+ neuroblasts, indicating enhanced differentiation of neural stem cells into the neuronal lineage .

In the SVZ specifically, Ttyh1 knockout results in a significant decrease in GFAP+/Sox2+ type-B neural stem cells, accompanied by an increase in EGFR+ transit-amplifying progenitors . This cell population shift suggests a role for Ttyh1 in maintaining the quiescent state of adult neural stem cells. Interestingly, the CD24+ ependymal cell population remains unchanged in knockout mice, indicating specificity in Ttyh1's effects on neural stem cells rather than a general effect on all ventricular cell types .

Behaviorally, Ttyh1 knockout mice exhibit enhanced spatial learning and memory capabilities as assessed by the Morris water maze test . During the probe test following training, knockout mice demonstrate significantly shorter latency times in platform searching compared to wild-type controls, suggesting improved cognitive function potentially linked to increased hippocampal neurogenesis.

Molecular analysis of Ttyh1 knockout effects shows alterations in the Notch signaling pathway, with decreased activity of this pathway consistent with Ttyh1's role in enhancing γ-secretase function and subsequently Notch activation . This molecular phenotype aligns with the observed cellular changes, as Notch signaling is a critical regulator of neural stem cell quiescence.

What methodologies are effective for studying Ttyh1's function in neuronal morphology?

Investigating Ttyh1's role in neuronal morphology requires specialized techniques that capture both molecular interactions and morphological changes. Several methodological approaches have proven effective in this research area:

Primary neuronal culture systems, particularly dissociated hippocampal neurons, provide an excellent model for studying Ttyh1's effects on neuronal morphology . These cultures allow for controlled manipulation of Ttyh1 expression through transfection or viral transduction, followed by detailed morphological analysis. Neurons can be cultured from embryonic rat or mouse brains (typically E18 for rats, E16-17 for mice) and maintained in vitro for periods sufficient to observe morphological development.

Advanced imaging techniques including high-resolution confocal microscopy and live-cell imaging are essential for capturing the subtle morphological changes induced by Ttyh1 manipulation. Neurons transfected with Ttyh1 expression constructs alongside fluorescent markers (like GFP) allow for visualization of cellular morphology in fixed samples or real-time tracking of morphological dynamics in living neurons.

Quantitative morphometric analysis is crucial for objectively assessing Ttyh1's effects on neuronal morphology. Parameters including dendritic length, branching complexity (Sholl analysis), spine density, and spine morphology provide comprehensive measures of neuronal development and maturation. Software tools such as ImageJ with the NeuronJ plugin, Neurolucida, or custom-designed image analysis algorithms facilitate consistent quantification.

Molecular manipulation approaches including overexpression, knockdown, and mutation studies help establish causal relationships between Ttyh1 and morphological outcomes. For knockdown studies, shRNA constructs targeting Ttyh1 have been successfully employed, with specificity validated through rescue experiments using shRNA-resistant Ttyh1 variants (Ttyh1res) . CRISPR/Cas9-mediated gene editing provides a more permanent genetic modification option for studying Ttyh1's role in neuronal development.

For in vivo analysis of neuronal morphology, in utero electroporation has proven valuable for introducing Ttyh1 expression constructs into developing neurons in the embryonic brain . This technique allows for subsequent examination of neuronal migration, positioning, and morphogenesis in the native brain environment.

Molecular pathway analysis focusing on Ttyh1's interaction with cytoskeletal regulators can help elucidate the mechanisms underlying its effects on neuronal morphology. Co-immunoprecipitation assays and proximity ligation assays can identify protein-protein interactions between Ttyh1 and cytoskeletal components or regulatory proteins.

How can Ttyh1's role in extracellular vesicle formation be leveraged for therapeutic applications?

Ttyh1's ability to induce formation of extracellular vesicles (EVs) with distinctive properties presents several potential therapeutic applications that researchers can explore using advanced methodological approaches:

Engineered EV delivery systems can be developed by exploiting Ttyh1's strong EV-inducing capacity. Research indicates that Ttyh1 produces approximately 5.6-fold more total EV membrane than Prominin 1, another EV-inducing protein . This high production efficiency makes Ttyh1 an attractive candidate for generating therapeutic EVs. Researchers can establish stable cell lines expressing Ttyh1 alongside therapeutic cargo proteins or RNAs, creating cellular factories for EV production. These EVs could potentially be harvested, purified, and used as delivery vehicles for therapeutic molecules.

The distinctive morphological characteristics of Ttyh1-induced EVs, particularly their tubulated structure and high protein content, may confer unique targeting capabilities or cellular uptake properties . Researchers can investigate these properties through differential ultracentrifugation for EV isolation, followed by nanoparticle tracking analysis, electron microscopy, and flow cytometry to characterize their physical properties. Cellular uptake studies using fluorescently labeled Ttyh1-EVs can assess their ability to deliver cargo to specific target cells.

For neural applications specifically, Ttyh1-EVs might serve as vehicles for delivering therapeutic factors to neural stem cells or neurons. Given Ttyh1's endogenous expression in neural tissues, its EVs may exhibit natural tropism for neural cells . This possibility can be investigated using primary neural cultures or organoid models to assess targeting efficiency and functional outcomes of Ttyh1-EV delivery.

Methodologically, researchers can employ CRISPR/Cas9 gene editing to create modified versions of Ttyh1 with enhanced EV-inducing properties or altered cargo-loading capabilities. Structure-function studies focusing on the transmembrane domains responsible for membrane bending could guide rational design of Ttyh1 variants optimized for therapeutic EV production.

When developing such applications, careful analysis of EV content is essential. Proteomics and RNA sequencing of Ttyh1-induced EVs compared to other EV populations can identify unique cargo components that might influence their therapeutic potential. Additionally, in vivo biodistribution studies using labeled Ttyh1-EVs would be necessary to understand their pharmacokinetics and targeting capabilities in animal models.

What are the most effective methodologies for studying Ttyh1's ion channel properties?

Investigating Ttyh1's function as a calcium-independent, volume-sensitive large conductance chloride channel requires specialized electrophysiological and imaging techniques:

Patch-clamp electrophysiology remains the gold standard for characterizing ion channel properties. For Ttyh1, whole-cell patch-clamp recordings in heterologous expression systems (such as HEK293 cells) transfected with Ttyh1 constructs allow for direct measurement of chloride currents. Several specific protocols are particularly relevant: volume-sensitive current protocols involving hypotonic challenges to activate volume-regulated channels; ion substitution protocols to confirm chloride selectivity; and pharmacological profiling using chloride channel blockers (such as DIDS, NPPB, or niflumic acid) to characterize Ttyh1's sensitivity profile.

For single-channel analysis, excised patch configurations (inside-out or outside-out) provide detailed information about Ttyh1's conductance properties, open probability, and gating kinetics. These measurements require high-resolution recording equipment capable of detecting large conductance channels, as Ttyh1 is characterized as a large conductance chloride channel .

Fluorescence-based methods offer complementary approaches for studying Ttyh1 channel function. Chloride-sensitive fluorescent indicators (such as MQAE or SPQ) can be used to monitor intracellular chloride levels in response to Ttyh1 expression and various stimuli. Similarly, cell volume measurements using calcein fluorescence quenching or 3D confocal microscopy can assess Ttyh1's role in volume regulation.

Molecular manipulation strategies are essential for structure-function studies. Site-directed mutagenesis targeting predicted pore-forming regions or regulatory domains can identify critical residues for Ttyh1's channel function. Generation of chimeric constructs between different Ttyh family members (Ttyh1, Ttyh2, and Ttyh3) can help identify domains responsible for specific functional properties.

For studying Ttyh1's physiological relevance as an ion channel in neurons, primary neuronal cultures from wild-type and Ttyh1 knockout animals provide valuable comparative models. Techniques such as gramicidin-perforated patch recordings, which preserve intracellular chloride concentrations, are particularly suitable for assessing native chloride channel function.

Advanced imaging techniques including super-resolution microscopy can reveal Ttyh1's subcellular localization and potential colocalization with other ion transport proteins or regulatory molecules. This is crucial for understanding Ttyh1's integration into broader ion homeostasis mechanisms in neurons.

How can transcriptional regulation of Ttyh1 be effectively studied in neural contexts?

Investigating the transcriptional regulation of Ttyh1 in neural contexts requires integrated approaches spanning from promoter analysis to in vivo regulation studies:

Promoter cloning and reporter assays represent fundamental tools for identifying and characterizing Ttyh1's regulatory elements. As demonstrated in previous research, cloning the rat Ttyh1 promoter sequence (592 bp) and fusing it upstream of a luciferase reporter gene in vectors such as pGL4.10[luc2] enables functional analysis of promoter activity . By creating deletion constructs targeting specific transcription factor binding sites, researchers can identify critical regulatory elements controlling Ttyh1 expression. The dual luciferase assay provides quantitative measurement of promoter activity under various conditions.

Identification of transcription factor binding sites through in silico analysis combined with experimental validation is essential. Bioinformatic tools can predict binding sites for transcription factors, with studies highlighting potential roles for specificity protein 1 (Sp1), E2F transcription factor 3 (E2f3), and achaete-scute homolog 1 (Ascl1) in regulating Ttyh1 expression . These predictions can be validated through electrophoretic mobility shift assays (EMSA) or chromatin immunoprecipitation (ChIP) to confirm actual binding of these factors to the Ttyh1 promoter in neural cells.

For studying context-dependent regulation in neural environments, primary neural cultures (such as dissociated hippocampal neurons) and neural stem cell cultures provide physiologically relevant models. The expression of Ttyh1 can be monitored under various differentiation conditions or following exposure to neuronal activity modulators, growth factors, or signaling pathway activators/inhibitors. Combining these treatments with reporter assays or direct measurement of endogenous Ttyh1 expression enables comprehensive analysis of regulatory mechanisms.

The Notch signaling pathway's role in regulating Ttyh1 merits particular attention given evidence that Ttyh1 is a direct transcriptional target of Notch . Manipulation of Notch signaling through NICD overexpression, γ-secretase inhibition, or expression of dominant-negative MAML1, followed by analysis of Ttyh1 expression, can elucidate this regulatory relationship. ChIP assays targeting Notch-responsive elements (such as RBP-J binding sites) in the Ttyh1 promoter can provide direct evidence of Notch-mediated transcriptional control.

For in vivo analysis of Ttyh1 regulation during development or in pathological contexts, transgenic reporter mice carrying the Ttyh1 promoter driving fluorescent protein expression would enable visualization of Ttyh1 transcriptional activity in the intact brain. Time-course studies during development or following experimental manipulations (such as injury models or disease induction) can reveal dynamic regulation of Ttyh1 expression in vivo.

What are common challenges in expressing and purifying recombinant Ttyh1 protein, and how can they be addressed?

Recombinant expression and purification of Ttyh1 present several technical challenges due to its transmembrane nature. Researchers commonly encounter issues and can implement specific strategies to overcome them:

Protein solubility issues are perhaps the most significant challenge, as Ttyh1 contains five transmembrane domains . Traditional bacterial expression systems often result in insoluble inclusion bodies when expressing such hydrophobic proteins. Strategies to address this include: using mammalian expression systems (HEK293 cells have been successfully employed) ; employing insect cell expression systems (Sf9 or Hi5 cells) which can better handle transmembrane proteins; and utilizing cell-free expression systems supplemented with detergents or lipid nanodiscs to provide a suitable hydrophobic environment during translation.

For purification approaches, detergent screening is critical for extracting Ttyh1 from membranes while maintaining its native structure. A systematic panel testing of detergents (ranging from harsh ionic detergents like SDS to milder non-ionic options like DDM, LMNG, or digitonin) can identify optimal solubilization conditions. Amphipols or SMA copolymers offer alternative approaches for maintaining membrane proteins in solution without conventional detergents.

Fusion tag selection significantly impacts expression and purification success. For Ttyh1, tags including His, Avi, Fc, and GST have been utilized . Small affinity tags like His6 or FLAG at the N-terminus may minimally impact protein function, while larger solubility-enhancing tags (MBP, SUMO, or TrxA) can improve expression yields. Importantly, tag placement must consider Ttyh1's topology—placing tags at cytoplasmic regions rather than transmembrane or extracellular domains helps maintain proper folding.

Protein instability during expression and purification can be mitigated through several approaches: expressing Ttyh1 at lower temperatures (16-30°C instead of 37°C) to slow protein synthesis and allow proper folding; adding chemical chaperones like glycerol or trimethylamine N-oxide to stabilize protein structure; and employing stabilizing mutations identified through alanine scanning or directed evolution approaches.

For functional characterization, reconstitution into a suitable membrane environment is essential. Options include proteoliposome reconstitution, nanodiscs, or direct purification in detergent micelles depending on the intended application. For ion channel studies specifically, ensuring the protein is correctly oriented during reconstitution is critical for meaningful functional assays.

Quality control measures are vital throughout the process. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can assess Ttyh1's oligomeric state and homogeneity. Circular dichroism spectroscopy provides information about secondary structure integrity, while functional assays like liposome-based ion flux assays can verify channel activity of the purified protein.

How can researchers address data inconsistencies when studying Ttyh1's effects on neural stem cells?

When investigating Ttyh1's effects on neural stem cells, researchers may encounter data inconsistencies stemming from methodological variables, biological complexity, or technical limitations. Several systematic approaches can help address these challenges:

Standardizing neural stem cell isolation and culture protocols is essential for reducing variability. Neural stem cells for Ttyh1 studies are typically isolated from embryonic brain tissue (E14.5 is commonly used) , but variations in isolation procedures, culture media composition, growth factor concentrations, and passage number can significantly impact experimental outcomes. Researchers should establish detailed protocols specifying dissection parameters, enzymatic digestion conditions, cell plating densities, and culture durations. For neurosphere assays specifically, standardizing sphere size measurement methods and defining clear criteria for what constitutes a neurosphere is critical.

Genetic background considerations are particularly important when using knockout models or transgenic approaches. Ttyh1 knockout mice may exhibit phenotypic variations depending on their genetic background, as neural stem cell characteristics and neurogenesis rates differ between mouse strains. Using appropriate littermate controls and maintaining consistent genetic backgrounds across experiments can minimize this source of variability.

For molecular pathway analysis focusing on Ttyh1's interaction with Notch signaling, timing of analysis is crucial. The dynamic nature of signaling pathways means that differences in sampling timepoints can produce apparently contradictory results. Time-course experiments examining Notch target gene expression, NICD levels, or γ-secretase activity at multiple timepoints following Ttyh1 manipulation can reveal temporal dynamics that resolve seeming inconsistencies.

Validation across multiple experimental models strengthens confidence in results and helps reconcile discrepancies. Comparing findings from in vitro neurosphere cultures, in vivo knockout models, and acute manipulation through in utero electroporation provides a more comprehensive understanding of Ttyh1's function. If inconsistencies persist across models, this may indicate context-dependent roles of Ttyh1 rather than experimental error.

Technical considerations for in utero electroporation experiments include: controlling for electroporation efficiency through co-expression of fluorescent reporters; ensuring targeting of the same neurogenic regions across animals; and standardizing post-electroporation time points for analysis. Variable electroporation efficiency can lead to misinterpretation of cell distribution patterns if not properly normalized.

For BrdU incorporation studies assessing proliferation, standardizing BrdU administration protocols (dosage, timing, and duration) and employing co-labeling with other markers (such as Sox2 for neural stem cells or DCX for neuroblasts) provides more precise information about which cell populations are affected by Ttyh1 manipulation .

Quantitative image analysis using automated, unbiased approaches rather than manual counting reduces observer bias. Software-based analysis of cell distribution patterns, marker expression levels, and morphological parameters ensures consistent application of classification criteria across experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.