Recombinant Rat Protein unc-50 homolog (Unc50)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will ship the format currently in stock. If you require a specific format, please specify this in your order notes.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs an additional fee.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during manufacturing.

The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
Unc50; Uncl; Protein unc-50 homolog; Uncoordinated-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Unc50
Target Protein Sequence
MLPSTSLNSSMYGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI DCVGVGLLISTLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFIN HVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVVLLYPFAPLIVLYGLSL ALGWNFTHTLCSFYKYRVK
Uniprot No.

Target Background

Function

Involved in the cell surface expression of neuronal nicotinic receptors. It also exhibits RNA-binding capabilities.

Database Links
Protein Families
Unc-50 family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain, kidney and testis, and at lower levels in heart.

Q&A

What is UNC50 and what are its known homologs across species?

UNC50 (unc-50 homolog) is a conserved protein originally identified in C. elegans with homologs present across multiple species. The protein is known by several synonyms including UNCL, URP, GMH1, and periodontal ligament-specific protein 22 (PDLs22) . UNC50 is highly conserved throughout evolution, with recombinant versions available from numerous species including human, rat, mouse, zebrafish, rhesus macaque, and chicken . The rat UNC50 gene corresponds to accession number NM_138919.3 and encodes a functional protein that shares significant structural and sequence homology with human UNC50 (UniProt ID: Q53HI1) .

What are the primary biological functions of UNC50?

UNC50 has several key biological functions as determined through comparative genomics and functional studies:

  • RNA binding activity - UNC50 demonstrates RNA binding capabilities, placing it in a functional category alongside proteins such as NOP56, FMR1, NOL4, and CAPRIN2 .

  • Membrane trafficking - As a homolog of yeast GMH1, UNC50 is implicated in intracellular protein transport and Golgi organization processes.

  • Protein-protein interactions - UNC50 directly interacts with several proteins including CREB3, GEA1, Tuba3a, and ENTHD2, suggesting roles in signaling pathways and cellular structural organization .

These functions position UNC50 as a multifunctional protein involved in cellular homeostasis and membrane dynamics.

What are the optimal conditions for storage and reconstitution of recombinant UNC50 protein?

For recombinant UNC50 protein, optimal storage and reconstitution follows specific parameters:

  • Storage conditions: Store lyophilized protein at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles .

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended default: 50%)

    • Prepare working aliquots and store at 4°C for up to one week

  • Buffer composition: The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose, pH 8.0 .

Repeated freezing and thawing significantly reduces protein activity and should be strictly avoided to maintain functional integrity of the recombinant protein.

What expression systems are most effective for producing functional Rat UNC50 protein?

Based on the available research data, several expression systems can effectively produce functional Rat UNC50:

Expression SystemApplicationsAdvantagesConsiderations
E. coliBiochemical studies, antibody productionHigh yield, cost-effective, rapid productionMay lack post-translational modifications
Mammalian cellsFunctional studies, protein-protein interaction analysisProper folding, authentic post-translational modificationsLower yield, higher cost
Adenoviral systemIn vivo studies, transient overexpressionHigh transduction efficiency (~100%), broad cell type rangeTransient expression (~ 7 days)
Lentiviral systemStable cell line generationIntegration into genome, works in non-dividing cellsMore complex production protocol

The adenoviral expression system is particularly effective for transient overexpression studies, with titers typically >1x10^6 pfu/mL, allowing for efficient transduction across multiple cell types regardless of their division status .

How can researchers verify successful expression of recombinant UNC50 protein in experimental systems?

Verification of successful UNC50 expression can be accomplished through multiple complementary approaches:

  • Western blot analysis: Using antibodies specific to either UNC50 or the fusion tag (His, GST, etc.). For tagged proteins, anti-tag antibodies provide reliable detection without requiring UNC50-specific antibodies.

  • qPCR analysis: For viral vector-based expression, primers designed against the UNC50 gene sequence can verify transcription. Successful transduction can typically be observed from 48 hours up to 5 days after infection .

  • Functional assays: Given UNC50's RNA binding capacity, RNA immunoprecipitation followed by detection of associated RNAs can confirm functional expression.

  • Subcellular localization: Immunofluorescence microscopy using tagged UNC50 constructs can verify proper cellular distribution consistent with its known membrane association patterns.

How can RNA-binding properties of UNC50 be characterized and measured in experimental settings?

The RNA-binding properties of UNC50 can be systematically characterized through multiple complementary techniques:

  • RNA Immunoprecipitation (RIP):

    • Express tagged UNC50 in rat cell lines

    • Cross-link protein-RNA complexes in vivo

    • Immunoprecipitate using anti-tag antibodies

    • Extract and analyze associated RNAs by sequencing or qPCR

  • Electrophoretic Mobility Shift Assay (EMSA):

    • Incubate purified recombinant UNC50 with labeled RNA probes

    • Analyze complex formation through gel electrophoresis

    • Competition assays with unlabeled RNA can determine binding specificity

  • Surface Plasmon Resonance (SPR):

    • Immobilize recombinant UNC50 on sensor chips

    • Flow RNA samples over the surface

    • Measure real-time binding kinetics and affinity constants

When designing these experiments, consider UNC50's functional relationship with other RNA-binding proteins such as NOP56, FMR1, and RBMX that may exhibit cooperative or competitive binding dynamics .

What experimental approaches can determine the interactome of UNC50 in rat neural tissues?

To comprehensively map the UNC50 interactome in rat neural tissues:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged UNC50 in rat neural cell lines or primary cultures

    • Perform pull-down experiments using anti-tag antibodies

    • Identify co-precipitated proteins by mass spectrometry

    • Validate interactions focusing on known partners (CREB3, GEA1, Tuba3a, ENTHD2)

  • Proximity-based labeling:

    • Generate BioID or APEX2 fusions with UNC50

    • Express in neural cells to label proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • Compare against known interactors to identify tissue-specific partners

  • Co-immunoprecipitation with validation:

    • Use antibodies against endogenous UNC50 in neural tissue lysates

    • Confirm interactions through reciprocal co-IP experiments

    • Perform stringency tests to differentiate between direct and indirect interactions

This multi-method approach helps distinguish between stable interactions and transient associations that may be functionally significant in neural contexts.

How does UNC50 contribute to membrane trafficking pathways in specialized cells?

UNC50's role in membrane trafficking can be investigated using these research approaches:

  • Fluorescent cargo tracking:

    • Express UNC50 wildtype or knockdown in specialized cells

    • Monitor trafficking of fluorescently-tagged cargo proteins

    • Perform time-lapse imaging to track dynamic changes

    • Quantify transport rates, directionality, and compartmental distribution

  • Organelle morphology analysis:

    • Use organelle-specific markers (Golgi, ER, endosomes) in cells with UNC50 modifications

    • Assess morphological changes using super-resolution microscopy

    • Quantify parameters such as fragmentation, size distribution, and positioning

  • Secretion assays:

    • Measure secreted reporter proteins in UNC50-modified cells

    • Compare constitutive versus regulated secretory pathways

    • Assess kinetics of secretion using pulse-chase experiments

These approaches can reveal whether UNC50 functions similarly to its yeast homolog GMH1 in maintaining Golgi organization and facilitating specific transport pathways in specialized rat cells such as neurons or secretory cells.

What are common issues when expressing recombinant UNC50 and how can they be resolved?

Researchers may encounter several challenges when working with recombinant UNC50:

ChallengePossible CausesSolutions
Low protein yieldToxicity to expression host, protein degradationOptimize induction conditions, use protease inhibitors, try different host strains
InsolubilityImproper folding, hydrophobic domainsExpress with solubility tags, optimize buffer conditions, use mild detergents
Loss of activity after purificationDenaturation, aggregationAdd stabilizing agents like trehalose (6%), maintain proper pH (8.0)
Inefficient viral transductionLow viral titer, cell-specific resistanceIncrease MOI, optimize transduction conditions, use polybrene/hexadimethrine bromide

For adenoviral expression systems, transduction efficiency can be monitored 48 hours to 5 days post-infection . If efficiency is low, consider pre-treating cells to enhance viral uptake or using alternative promoters better suited to your specific cell type.

How can the purity and functionality of recombinant UNC50 be assessed prior to experimental use?

To ensure experimental reliability, verify both purity and functionality:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (target: >90% purity)

    • Western blotting with anti-UNC50 or anti-tag antibodies

    • Size exclusion chromatography to detect aggregates

    • Mass spectrometry for absolute purity confirmation

  • Functionality tests:

    • RNA binding assay to confirm biochemical activity

    • Circular dichroism to verify proper protein folding

    • Thermal shift assays to assess protein stability

    • Activity-specific assays depending on the experimental context

When working with His-tagged UNC50, potential imidazole carryover from purification can interfere with downstream applications. Consider dialysis or buffer exchange steps prior to functional studies if activity appears compromised.

What strategies can overcome low transduction efficiency when using UNC50 adenoviral vectors?

When facing challenges with adenoviral transduction of UNC50:

  • Optimization parameters:

    • Increase viral concentration (starting recommendation: >1x10^6 pfu/mL)

    • Adjust cell density (typically 70-80% confluence is optimal)

    • Extend infection time from standard 24h to 48h

    • Reduce serum concentration during initial viral exposure

  • Enhancement approaches:

    • Add polybrene (2-8 μg/mL) to increase adsorption

    • Centrifuge plates during infection (spinoculation)

    • Pre-treat cells with compounds that enhance endocytosis

    • Consider cell-specific factors that might influence receptor expression

  • Validation methods:

    • Include GFP-expressing control virus to assess general transduction efficiency

    • Verify expression by qPCR using primers specific to UNC50

    • Confirm protein expression 48 hours to 5 days post-infection

Adenoviral systems offer nearly 100% transduction efficiency across diverse cell types independent of cell division status, making them ideal for transient UNC50 expression studies despite their limited expression duration (~7 days) .

How should researchers account for tag-specific effects when studying UNC50 function?

When interpreting data from tagged UNC50 experiments:

  • Control strategies:

    • Compare multiple tag positions (N-terminal vs. C-terminal)

    • Include tag-only control constructs

    • Validate key findings with untagged protein when possible

    • Compare different tag types (His, GST, Fc, Avi) for critical experiments

  • Functional considerations:

    • The His tag is relatively small and generally minimally disruptive

    • Larger tags like GST may interfere with membrane insertion properties

    • C-terminal tags may affect protein-protein interactions, particularly with CREB3 and GEA1

    • Tag position may alter RNA binding capacity

  • Analytical approaches:

    • Perform comparative binding assays between differently tagged versions

    • Use structural prediction to identify potential tag interference with functional domains

    • Consider tag removal via protease cleavage for critical functional studies

Researchers should acknowledge tag-specific limitations in their experimental design and interpretation, particularly when studying membrane-associated functions of UNC50.

What considerations are important when comparing UNC50 function across different model systems?

When conducting comparative UNC50 studies:

  • Sequence and structural variations:

    • Analyze alignment between rat UNC50 and other species homologs

    • Identify conserved versus variable regions that may affect function

    • Consider species-specific post-translational modifications

  • Experimental system differences:

    • Account for expression level variations between systems

    • Consider cellular context differences (e.g., interacting proteins may vary)

    • Adjust protocols for cell-type specific requirements

    • Normalize data appropriately when making cross-species comparisons

  • Functional conservation analysis:

    • Perform rescue experiments to test functional interchangeability

    • Design chimeric proteins to map species-specific functional domains

    • Use evolutionary analysis to identify selective pressure on specific regions

The high conservation of UNC50 across species suggests functional importance, but subtle differences may reveal species-specific adaptations that should be considered when translating findings between models.

How can researchers distinguish between direct and indirect effects in UNC50 knockdown or overexpression studies?

To differentiate direct from indirect UNC50 effects:

  • Temporal analysis:

    • Perform time-course experiments after induction/knockdown

    • Early changes (12-24h) more likely represent direct effects

    • Late changes (48h+) often reflect secondary adaptations

  • Rescue experiments:

    • Re-express UNC50 in knockdown models

    • Use domain mutants to map functional regions

    • Express predicted downstream effectors to bypass UNC50 requirement

  • Mechanistic validation:

    • Perform in vitro reconstitution with purified components

    • Use proximity labeling to identify direct interaction partners

    • Compare acute versus chronic manipulation effects

  • Controls and validation:

    • Include multiple independent knockdown/overexpression approaches

    • Use dose-response relationships to establish causality

    • Validate key findings with orthogonal methods

When using adenoviral expression systems for UNC50 overexpression, remember that expression is transient (~7 days), which can help distinguish between immediate effects and long-term adaptations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.