Recombinant Rat Protein YIF1B (Yif1b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Yif1b; Protein YIF1B; YIP1-interacting factor homolog B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Yif1b
Target Protein Sequence
MHATGLAAPAGTPRLRKWPSKRRVPVSQPGMADPHQFFDDTSSAPSRGYGGQPSPGSLGY PTSSSEAAFLAAPMSNMAMAYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKK LGLLVFPYLHQDWEVQYQQDTPVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRMIG GVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPVRGARNQLRMYLTM AVAAAQPVLMYWLTFHLVR
Uniprot No.

Target Background

Function

YIF1B is involved in anterograde trafficking from the endoplasmic reticulum to the plasma membrane and in the organization of Golgi architecture. It plays a crucial role in targeting receptors, such as the 5-HT1A receptor, to neuronal dendrites.

Gene References Into Functions
  1. A novel protein trafficking pathway model proposes Yif1B as a scaffold protein recruiting the 5-HT1A receptor complex. PMID: 23055492
Database Links

KEGG: rno:292768

UniGene: Rn.154471

Protein Families
YIF1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in brain. Expressed in heart, kidney, and lung and lower levels in spleen, muscle, and intestine (at protein level). Expressed in serotoninergic neurons (at protein level).

Q&A

What is YIF1B and what are its primary functions in rat neuronal cells?

YIF1B (YIP1-interacting factor homolog B) is a multi-pass membrane protein belonging to the YIF1 family. It functions primarily as a component of the ER/Golgi trafficking machinery, playing a key role in specific targeting of proteins to neuronal dendrites . In rat neurons, YIF1B is highly expressed in the brain, particularly in raphe 5-HT1AR-expressing neurons, where it mediates the dendritic targeting of specific receptors . YIF1B is involved in intracellular membrane trafficking and protein targeting, making it essential for organelle biogenesis and maintenance .

Methodologically, researchers studying YIF1B's basic functions should employ immunohistochemistry with specific anti-YIF1B antibodies on rat brain sections to visualize its expression patterns, combined with subcellular fractionation techniques to isolate membrane compartments where YIF1B localizes.

How does the structure of Rat YIF1B compare to human and mouse orthologs?

Rat YIF1B shares significant homology with human and mouse orthologs. Human YIF1B control fragment (aa 35-142) shows 81% sequence identity with both mouse and rat YIF1B proteins . Similarly, human YIF1B control fragment (aa 36-108) exhibits 77% identity with mouse and rat orthologs .

For researchers working across species, it's important to note these sequence similarities when designing experiments or antibodies. When analyzing protein functionality across species, sequence alignment tools should be employed to identify conserved domains that likely maintain similar functions. Critical protein regions should be validated through site-directed mutagenesis studies to confirm functional conservation.

What are the optimal expression systems for producing functional recombinant Rat YIF1B?

While the search results don't specifically detail expression systems for Rat YIF1B, we can infer from standard recombinant protein methodology and related proteins in the search results:

For membrane proteins like YIF1B, mammalian expression systems such as HEK293 or tsA201 cells (as used for 5-HT1AR in search result ) often provide proper folding and post-translational modifications. For structural studies requiring high yields, insect cell expression systems (Sf9 or Hi5) may be preferable.

The methodological approach should involve:

  • Cloning the rat YIF1B cDNA into an appropriate expression vector with a purification tag (His-tag or GST-tag)

  • Transfecting mammalian cells or creating stable cell lines

  • Optimizing expression conditions (temperature, induction time)

  • Extracting the membrane fraction using detergents compatible with maintaining YIF1B structure

  • Purifying using affinity chromatography followed by size exclusion chromatography

For quality control, assess protein purity by SDS-PAGE and verify structural integrity through circular dichroism or limited proteolysis.

What purification strategies yield the highest purity and functionality for recombinant Rat YIF1B?

As a multi-pass membrane protein, YIF1B purification requires specific considerations:

  • Detergent selection: Begin with a screen of mild detergents (DDM, LMNG, CHAPS) to solubilize YIF1B while maintaining its native conformation

  • Two-step purification:

    • Initial purification using affinity chromatography (Ni-NTA for His-tagged constructs)

    • Secondary purification using size exclusion chromatography to remove aggregates and contaminants

  • Buffer optimization:

    • Include glycerol (10-15%) to enhance stability

    • Add reducing agents (DTT or TCEP) to prevent disulfide bond formation

    • Test protein stability in various pH conditions (typically pH 7.0-8.0)

Quality assessment should include:

  • Analytical SEC to verify monodispersity

  • Functional assays to confirm activity (e.g., binding to known interaction partners)

  • Western blot to confirm identity and integrity

How does YIF1B mediate the targeting of 5-HT1A receptors to neuronal dendrites?

YIF1B specifically interacts with the C-terminal domain of the 5-HT1A receptor, playing a crucial role in its dendritic targeting. The interaction was confirmed through yeast two-hybrid screening and GST pull-down experiments . Colocalization of YIF1B and 5-HT1AR was observed in small vesicles involved in transient intracellular trafficking .

The mechanistic pathway involves:

  • YIF1B binding to the C-terminus of 5-HT1AR in the ER/Golgi

  • Formation of transport vesicles containing both proteins

  • Selective transport along dendrites via interaction with trafficking machinery

  • Delivery of 5-HT1AR to specific dendritic membrane domains

This was demonstrated experimentally through siRNA inhibition of endogenous YIF1B expression in primary neuron cultures, which specifically prevented the addressing of 5-HT1AR to distal portions of dendrites without affecting other receptors such as sst2A, P2X2, and 5-HT3A receptors .

What experimental approaches can identify novel protein interactions with YIF1B in rat neuronal cells?

For identifying novel YIF1B protein interactions in rat neuronal cells, several complementary approaches should be employed:

  • Proximity-dependent biotin identification (BioID):

    • Express YIF1B fused to a promiscuous biotin ligase (BirA*) in rat neurons

    • Biotinylated proteins (proximity partners) are captured by streptavidin and identified by mass spectrometry

    • Provides information about the spatial context of interactions

  • Co-immunoprecipitation followed by mass spectrometry:

    • Use anti-YIF1B antibodies to pull down YIF1B complexes from rat brain extracts

    • Identify co-precipitated proteins by LC-MS/MS

    • Validate interactions through reciprocal co-IP experiments

  • Yeast two-hybrid screening:

    • Similar to how YIF1B was identified as a 5-HT1AR partner

    • Use rat neuronal cDNA library as prey and YIF1B as bait

    • Verify positive interactions through GST pull-down assays

  • FRET/BRET assays:

    • Express YIF1B fused to a donor fluorophore and candidate partners fused to acceptor fluorophores

    • Measure energy transfer as evidence of protein proximity

    • Useful for confirming interactions in living cells

Data analysis should include:

  • Elimination of common contaminants using CRAPome database

  • Enrichment analysis comparing to control pull-downs

  • Network analysis to identify functional protein clusters

What are the most effective siRNA transfection protocols for YIF1B knockdown in primary rat neurons?

Based on the successful knockdown of YIF1B in primary rat neurons described in search result , the following methodological approach is recommended:

Optimized Protocol for YIF1B siRNA Transfection in Primary Rat Neurons:

  • siRNA Design and Selection:

    • Target sequences within the coding region of rat YIF1B mRNA

    • Design 3-4 different siRNA sequences to identify the most effective

    • Include a scrambled siRNA control with similar GC content

  • Neuron Preparation:

    • Culture rat embryonic neurons (E17-E19) on poly-D-lysine coated surfaces

    • Allow neurons to develop for 7-10 days in vitro before transfection

    • Ensure 70-80% confluence at time of transfection

  • Transfection Method:

    • Use Lipofectamine RNAiMAX or Neuromag (magnetofection) reagents

    • For magnetofection: Mix siRNA (final concentration 50-100nM) with Neuromag in Neurobasal medium without supplements

    • Incubate 15-20 minutes at room temperature

    • Add to neurons dropwise and place on magnetic plate for 15 minutes

    • Return to incubator for 48-72 hours

  • Validation of Knockdown:

    • Quantify YIF1B mRNA levels by RT-qPCR at 24-48 hours post-transfection

    • Assess protein knockdown by Western blot at 48-72 hours post-transfection

    • Evaluate functional effects through immunocytochemistry to observe changes in receptor localization

Optimization parameters should include siRNA concentration (25-100nM range), transfection reagent amount, and incubation time to achieve maximum knockdown with minimal toxicity.

How can mass spectrometry be effectively used to characterize post-translational modifications of Rat YIF1B?

Mass spectrometric characterization of Rat YIF1B post-translational modifications (PTMs) requires a systematic approach similar to that used for the 5-HT1AR characterization described in search result :

Comprehensive MS Protocol for YIF1B PTM Analysis:

  • Sample Preparation:

    • Express recombinant Rat YIF1B in an appropriate cell line (HEK293 or tsA201)

    • Extract using multiple detergent conditions to ensure complete solubilization

    • Purify using affinity chromatography

  • Multiple Enzymatic Digestions:

    • Perform parallel digestions with different proteases:

      • Trypsin (cleaves at K and R)

      • Chymotrypsin (cleaves at F, Y, W)

      • AspN (cleaves N-terminal to D)

      • Proteinase K and pepsin for broad coverage

  • Enrichment Strategies for Specific PTMs:

    • Phosphorylation: TiO2 or IMAC enrichment

    • Glycosylation: Lectin affinity or hydrazide chemistry

    • Ubiquitination: K-ε-GG antibody enrichment

  • MS Analysis:

    • Use high-resolution MS instruments (Orbitrap)

    • Implement data-dependent acquisition for discovery

    • Follow with parallel reaction monitoring for targeted analysis of identified PTMs

  • Data Analysis:

    • Use multiple search engines (Mascot and Modiro™ as in )

    • Apply appropriate false discovery rate controls

    • Validate identified PTMs through site-directed mutagenesis

  • Validation of Key PTMs:

    • Generate phospho-specific antibodies for major phosphorylation sites

    • Use phosphatase treatment to confirm phosphorylation sites

    • Perform functional assays with PTM site mutants

This approach should aim for >90% sequence coverage, similar to the 94.55% achieved for 5-HT1AR , to ensure comprehensive PTM identification.

How does YIF1B dysregulation contribute to neurodegenerative disorders in rat models?

While the search results don't provide specific information on YIF1B in rat neurodegenerative models, we can extrapolate from its known functions:

YIF1B plays a critical role in neuronal protein trafficking, particularly for the 5-HT1A receptor . Dysregulation of this trafficking mechanism could potentially contribute to neurodegenerative processes through several mechanisms:

  • Impaired Serotonergic Signaling:

    • Dysfunction in 5-HT1AR trafficking could alter serotonergic tone

    • Altered serotonergic signaling is implicated in depression and cognitive impairment associated with neurodegenerative diseases

  • Compromised Protein Quality Control:

    • YIF1B function in ER/Golgi trafficking suggests a role in protein quality control

    • Disruption could lead to accumulation of misfolded proteins, a hallmark of neurodegenerative disorders

To investigate these hypotheses, researchers should:

  • Develop conditional YIF1B knockout rat models:

    • Use CRISPR/Cas9 to generate brain region-specific YIF1B deletion

    • Characterize behavioral phenotypes related to cognitive function and affective behavior

    • Assess progressive neurodegeneration through histological examination

  • Establish protein trafficking assays:

    • Use live-cell imaging with fluorescently tagged cargo proteins in primary neurons

    • Quantify trafficking defects upon YIF1B manipulation

    • Correlate trafficking deficits with neuronal health markers

  • Analyze post-mortem tissue from neurodegenerative disease models:

    • Compare YIF1B expression and localization in affected vs. unaffected brain regions

    • Examine correlation between YIF1B levels and disease markers

What role does YIF1B play in regulating neuroinflammatory responses in rat models?

The search results don't directly address YIF1B's role in neuroinflammation, but given the importance of intracellular trafficking in immune responses, this represents an important research direction.

Proposed Experimental Approach:

  • Expression analysis in inflammatory conditions:

    • Treat primary rat microglia and astrocytes with inflammatory stimuli (LPS, IL-1α/β, IFN-γ)

    • Measure YIF1B expression changes at mRNA and protein levels

    • Correlate with inflammatory marker expression

  • YIF1B manipulation in glial cells:

    • Knockdown or overexpress YIF1B in primary rat microglia

    • Measure changes in:

      • Cytokine production (IL-1α, IL-1β, TNF-α)

      • Phagocytic activity

      • Microglial polarization (M1/M2 markers)

  • Assessment in neuroinflammation models:

    • Utilize rat models of neuroinflammation (LPS injection, EAE)

    • Compare YIF1B expression in inflamed vs. healthy CNS tissue

    • Investigate whether YIF1B knockdown alters disease progression

  • Trafficking of immune receptors:

    • Investigate whether YIF1B mediates trafficking of TLRs or cytokine receptors

    • Use similar approaches to those that identified its role in 5-HT1AR trafficking

  • Interaction with neuroinflammatory pathways:

    • Perform co-immunoprecipitation studies to identify potential interactions between YIF1B and inflammatory signaling components

    • Investigate whether YIF1B affects NF-κB translocation or MAPK signaling

How should researchers interpret contradictory findings regarding YIF1B functions across different rat cell types?

When faced with contradictory findings regarding YIF1B functions across different rat cell types, researchers should employ a systematic analytical approach:

  • Context-dependent protein interactions:

    • YIF1B may interact with different partner proteins depending on the cell type

    • Perform cell-type specific interactome analysis using BioID or IP-MS

    • Create interaction network maps to identify cell-type specific partners

  • Expression level considerations:

    • Quantify absolute YIF1B expression levels across cell types using quantitative Western blotting

    • Correlate function with expression level to identify potential threshold effects

    • Consider isoform expression differences using isoform-specific qPCR

  • Subcellular localization analysis:

    • Perform high-resolution imaging to determine precise localization in different cell types

    • Correlate functional differences with localization patterns

    • Use fractionation to biochemically confirm localization differences

  • Experimental design reconciliation:

    • Create a standardized experimental framework to test YIF1B function across cell types

    • Control for variables like cell culture conditions, passage number, and confluence

    • Use the same reagents (antibodies, constructs) across experiments

  • Data integration approach:

    • Employ mathematical modeling to integrate contradictory data

    • Consider the possibility that contradictions reflect genuine biological complexity

    • Develop testable hypotheses that could explain observed differences

Cell TypePotential YIF1B FunctionExperimental Approach
NeuronsReceptor traffickingLive imaging of fluorescently tagged receptors
GliaInflammatory response regulationCytokine profiling after YIF1B manipulation
Endothelial CellsBlood-brain barrier maintenancePermeability assays following YIF1B knockdown
Neural Stem CellsDifferentiation regulationLineage tracing with YIF1B genetic manipulation

What statistical approaches are most appropriate for analyzing YIF1B trafficking dynamics in live-cell imaging experiments?

For analyzing YIF1B trafficking dynamics in live-cell imaging experiments, researchers should implement robust statistical approaches tailored to temporal and spatial data:

  • Particle Tracking Analysis:

    • Track individual YIF1B-positive vesicles using automated tracking algorithms

    • Calculate key parameters:

      • Mean square displacement (MSD)

      • Instantaneous and average velocities

      • Directionality ratio

      • Pause frequency and duration

    • Apply mixed-effects models to account for nested data structure (multiple vesicles per cell, multiple cells per experiment)

  • Colocalization Analysis Over Time:

    • Quantify dynamic colocalization with markers of different cellular compartments

    • Use Pearson's correlation coefficient, Manders' overlap coefficient, or object-based colocalization

    • Implement time-series analysis to detect trends in colocalization patterns

  • Flux Analysis:

    • Measure net movement of YIF1B between cellular compartments

    • Implement photoactivatable or photoconvertible YIF1B constructs

    • Apply compartmental modeling with differential equations

  • Statistical Testing Framework:

    • For comparing treatment groups:

      • Apply linear mixed models for repeated measures data

      • Use permutation tests for non-normally distributed parameters

      • Implement bootstrap confidence intervals for robust estimation

    • For multiple comparison correction:

      • Use false discovery rate control (Benjamini-Hochberg procedure)

      • Consider the temporal dependency structure when applying corrections

  • Machine Learning Approaches:

    • Train convolutional neural networks to automatically classify trafficking events

    • Implement unsupervised clustering to identify distinct trafficking behaviors

    • Use dimension reduction techniques (t-SNE, UMAP) to visualize complex trafficking patterns

Trafficking ParameterRecommended Statistical ApproachInterpretation Guidance
Vesicle SpeedNested ANOVA or mixed-effects modelCompare medians rather than means due to typical skewed distribution
Directional PersistenceCircular statistics (Watson's U² test)Values close to 1 indicate directed movement; values close to 0 indicate random motion
Trafficking FrequencyPoisson regressionAccount for cell size differences by normalizing to membrane or cytoplasm area
Compartment TransitionsMarkov modelingAllows prediction of trafficking patterns and identification of rate-limiting steps

What are the common pitfalls in recombinant Rat YIF1B expression and purification, and how can they be addressed?

Based on principles applicable to membrane proteins like YIF1B, researchers should be aware of these common pitfalls and their solutions:

  • Low Expression Yields:

    • Problem: Multi-pass membrane proteins often express poorly

    • Solutions:

      • Test multiple expression systems (E. coli, insect cells, mammalian cells)

      • Optimize codon usage for the expression host

      • Include fusion tags (MBP, SUMO) to enhance solubility

      • Lower expression temperature (16-25°C) to allow proper folding

      • Consider using protein synthesis inhibitors (e.g., cycloheximide) at low concentrations to slow translation

  • Protein Aggregation:

    • Problem: Membrane proteins tend to aggregate during extraction/purification

    • Solutions:

      • Screen multiple detergents (DDM, LMNG, GDN) for extraction

      • Include stabilizing additives (glycerol, cholesterol hemisuccinate)

      • Maintain sample at 4°C throughout purification

      • Consider nanodiscs or SMALPs for detergent-free extraction

      • Use size exclusion chromatography to remove aggregates

  • Proteolytic Degradation:

    • Problem: YIF1B may be susceptible to proteolysis during purification

    • Solutions:

      • Include protease inhibitor cocktails at all stages

      • Perform purification rapidly (within 24-48 hours)

      • Identify and mutate susceptible sites identified by mass spectrometry

      • Consider using protease-deficient expression strains

  • Loss of Functionality:

    • Problem: Purified YIF1B may lose its ability to interact with partners

    • Solutions:

      • Develop robust functional assays to test activity during purification

      • Co-express with stabilizing interaction partners

      • Use mild solubilization conditions

      • Consider purifying intact membrane patches rather than isolated protein

  • Improper Folding:

    • Problem: Recombinant expression may lead to misfolded protein

    • Solutions:

      • Use CD spectroscopy to monitor secondary structure

      • Consider limited proteolysis to assess structural integrity

      • Implement thermal shift assays to optimize buffer conditions

      • Co-express with chaperones to improve folding

IssueDiagnostic MethodOptimization Strategy
AggregationSize exclusion chromatography profileDetergent screening (8-12 different detergents)
DegradationSDS-PAGE and Western blot analysisProtease inhibitor optimization
MisfoldingCircular dichroism spectroscopyBuffer component screening (pH, salt, additives)
Low yieldQuantitative Western blotExpression vector and cell line optimization
Inactive proteinBinding assays with known partnersGentle purification methods

How can researchers troubleshoot problems in YIF1B subcellular localization studies?

When investigating YIF1B subcellular localization, researchers may encounter several challenges. Here is a systematic troubleshooting guide:

  • Non-specific Antibody Binding:

    • Problem: False localization patterns due to antibody cross-reactivity

    • Troubleshooting:

      • Validate antibodies using YIF1B knockdown or knockout controls

      • Perform peptide competition assays to confirm specificity

      • Compare localization patterns using multiple antibodies against different epitopes

      • Use tagged YIF1B constructs as complementary approach

  • Fixation Artifacts:

    • Problem: Different fixation methods may alter membrane protein localization

    • Troubleshooting:

      • Compare multiple fixation protocols (4% PFA, methanol, glutaraldehyde)

      • Use live-cell imaging with fluorescently tagged YIF1B when possible

      • Perform subcellular fractionation to biochemically confirm localization

      • Apply mild permeabilization conditions to preserve membrane structures

  • Overexpression Artifacts:

    • Problem: Tagged YIF1B overexpression may cause mislocalization

    • Troubleshooting:

      • Titrate expression levels using inducible promoters

      • Compare localization at different expression levels

      • Use genome editing to tag endogenous YIF1B

      • Validate with immunostaining of endogenous protein

  • Poor Resolution of Membrane Compartments:

    • Problem: Difficulty distinguishing between similar membranous compartments

    • Troubleshooting:

      • Use super-resolution microscopy (STED, PALM, STORM)

      • Employ correlative light and electron microscopy (CLEM)

      • Utilize a panel of compartment-specific markers for colocalization

      • Implement immuno-EM for nanoscale localization

  • Dynamic Trafficking Not Captured:

    • Problem: Static images miss dynamic trafficking events

    • Troubleshooting:

      • Implement time-lapse imaging with appropriate temporal resolution

      • Use photoactivatable or photoconvertible YIF1B constructs

      • Apply FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

      • Consider temperature blocks to synchronize trafficking events

Localization IssueDiagnostic ApproachResolution Strategy
Antibody specificity concernsWestern blot with competing peptidesValidate with multiple YIF1B antibodies or epitope tags
Inconsistent patterns between experimentsSystematic comparison of fixation methodsStandardize protocols with detailed SOPs
Diffuse vs. punctate distributionZ-stack confocal imagingDeconvolution and 3D reconstruction
Quantification challengesColocalization coefficient analysisImplement automated image analysis pipelines
Contradictory results between imaging and biochemical approachesSubcellular fractionation with Western blotEmploy multiple complementary techniques

What emerging technologies will advance our understanding of YIF1B's role in neuronal protein trafficking?

Several cutting-edge technologies are poised to revolutionize our understanding of YIF1B's role in neuronal protein trafficking:

  • Proximity Labeling Proteomics:

    • Techniques like TurboID and APEX2 allow temporal mapping of YIF1B's protein neighborhood

    • Implementation in specific neuronal compartments can reveal region-specific interactions

    • Methodological approach:

      • Express YIF1B-TurboID fusion in rat primary neurons

      • Apply biotin pulses at different timepoints during trafficking events

      • Identify biotinylated proteins by streptavidin pull-down and mass spectrometry

      • Construct temporal interaction networks

  • Super-Resolution Live-Cell Imaging:

    • Lattice light-sheet microscopy with adaptive optics enables:

      • Long-term imaging with minimal phototoxicity

      • 3D visualization of trafficking events in intact neurons

      • Simultaneous tracking of multiple proteins in different colors

    • Implementation strategy:

      • Generate knock-in fluorescent tags at endogenous YIF1B locus

      • Visualize trafficking in dendrites with nanometer precision

      • Quantify dynamics using advanced particle tracking algorithms

  • Optogenetic Control of Trafficking:

    • Light-inducible protein-protein interactions allow temporal control of YIF1B function

    • Experimental design:

      • Fuse YIF1B to photosensitive domains (CRY2-CIB1 or iLID system)

      • Trigger specific interactions with light pulses

      • Measure effects on cargo localization and trafficking rates

      • Map functional domains through specific optogenetic recruitment

  • Cryo-Electron Tomography:

    • Visualizes macromolecular complexes in their native cellular environment

    • Approach for YIF1B research:

      • Prepare vitrified neuronal samples containing YIF1B trafficking vesicles

      • Identify vesicles through correlative light-electron microscopy

      • Reconstruct 3D architecture of trafficking machinery

      • Determine YIF1B's position within these complexes

  • Synthetic Biology Approaches:

    • De novo design of minimal trafficking systems containing YIF1B

    • Experimental strategy:

      • Reconstitute trafficking machinery in artificial membranes

      • Systematically add and remove components

      • Identify minimal requirements for directional trafficking

      • Test hypotheses in cellular models

TechnologyKey AdvantageMethodological Implementation
Proximity LabelingCaptures transient interactionsPulse-chase experimental design with varied biotin exposure times
Light-Sheet MicroscopyLow phototoxicity for long-term imagingMulti-angle illumination with deconvolution algorithms
OptogeneticsPrecise temporal controlSubcellular light targeting with digital micromirror devices
Cryo-ETNative structural contextCorrelative workflow with fluorescence pre-identification
Synthetic BiologyReductionist approach to complex systemsBottom-up reconstitution in giant unilamellar vesicles

How might integrative multi-omics approaches enhance our understanding of YIF1B regulation in neuropathological conditions?

Integrative multi-omics approaches offer unprecedented insights into YIF1B regulation in neuropathological conditions through systematic data integration:

  • Multi-level Omics Data Generation:

    • Genomics: Identify genetic variants affecting YIF1B expression or function in rat disease models

    • Transcriptomics: Map YIF1B isoform expression across brain regions and disease states

    • Proteomics: Quantify YIF1B protein levels and interactome changes

    • Phosphoproteomics: Identify regulatory phosphorylation events on YIF1B

    • Metabolomics: Correlate metabolic signatures with YIF1B function

  • Computational Integration Framework:

    • Implement Bayesian network analysis to:

      • Infer causal relationships between different molecular layers

      • Identify key regulatory nodes affecting YIF1B function

      • Model the impact of perturbations on system behavior

    • Apply machine learning for pattern recognition:

      • Identify molecular signatures associated with YIF1B dysfunction

      • Develop predictive models of disease progression

      • Discover potential intervention points

  • Spatial Multi-omics Implementation:

    • Employ spatial transcriptomics and proteomics to:

      • Map YIF1B expression in specific brain regions

      • Correlate with regional vulnerability in disease models

      • Identify cell type-specific regulatory mechanisms

    • Methodological approach:

      • Apply Visium spatial transcriptomics to rat brain sections

      • Implement CODEX multiplexed protein imaging

      • Correlate spatial patterns across modalities using computational alignment

  • Single-cell Multi-omics:

    • Analyze YIF1B regulation at single-cell resolution:

      • Identify cell populations with distinctive YIF1B expression

      • Characterize cell state-dependent regulation

      • Map cellular trajectories during disease progression

    • Technical implementation:

      • Apply scRNA-seq and scATAC-seq to dissociated rat brain tissue

      • Implement computational pseudotime analysis

      • Correlate chromatin accessibility with YIF1B expression

  • Perturbation-based Multi-omics:

    • Systematic perturbation to uncover regulatory mechanisms:

      • CRISPR screening of YIF1B regulatory elements

      • Pharmacological modulation of pathways affecting YIF1B

      • Environmental stress factors relevant to neuropathology

    • Experimental design:

      • Apply perturbations in cellular or animal models

      • Collect multi-omics data at multiple timepoints

      • Construct dynamic regulatory networks

Omics LayerTechnology PlatformIntegration Strategy
GenomicsWhole-genome sequencingeQTL mapping to YIF1B expression
TranscriptomicsRNA-seq with long-read technologyIsoform-specific quantification
ProteomicsTMT-based quantitative proteomicsCorrelation with transcript levels
InteractomicsBioID combined with mass spectrometryNetwork analysis with disease-associated proteins
EpigenomicsCUT&RUN for histone modificationsIdentification of regulatory elements

This integrative approach would enable researchers to construct comprehensive models of YIF1B regulation in health and disease, potentially revealing novel therapeutic targets for neuropathological conditions.

What are the recommended quality control standards for validating recombinant Rat YIF1B protein preparations?

A comprehensive quality control framework for recombinant Rat YIF1B should include:

  • Purity Assessment:

    • SDS-PAGE Analysis:

      • Silver staining to detect contaminants (>95% purity recommended)

      • Western blot with anti-YIF1B antibodies to confirm identity

    • Mass Spectrometry:

      • Intact mass analysis to confirm molecular weight

      • Peptide mapping to achieve >90% sequence coverage

      • Contaminant analysis with sensitivity to 0.1% impurities

  • Structural Integrity Verification:

    • Circular Dichroism (CD) Spectroscopy:

      • Confirm expected secondary structure composition

      • Monitor thermal stability through melting curves

    • Limited Proteolysis:

      • Compare digestion patterns to properly folded standards

      • Identify flexible and protected regions

  • Functional Validation:

    • Binding Assays:

      • Surface Plasmon Resonance (SPR) with known interaction partners

      • Pull-down assays with rat brain lysates

    • Trafficking Assays:

      • Rescue experiments in YIF1B-knockdown neurons

      • Measurement of cargo protein localization

  • Biochemical Characterization:

    • Size Exclusion Chromatography:

      • Assess monodispersity (single, symmetric peak)

      • Determine oligomeric state

    • Dynamic Light Scattering:

      • Confirm homogeneity of the preparation

      • Monitor for aggregation tendencies

  • Post-translational Modification Analysis:

    • Phosphorylation Site Mapping:

      • Identify physiologically relevant phosphorylation sites

      • Quantify site occupancy

    • Other PTMs:

      • Assess glycosylation if expressed in mammalian systems

      • Identify other modifications that may affect function

Quality ParameterAcceptance CriteriaMethod
Purity>95%Silver-stained SDS-PAGE
Identity>90% sequence coverageLC-MS/MS peptide mapping
HomogeneityPolydispersity index <0.2Dynamic light scattering
Functional activityKD within 2-fold of native proteinSurface plasmon resonance
Endotoxin content<0.1 EU/μg proteinLAL assay
Stability<10% degradation after 1 week at 4°CSEC and SDS-PAGE

What are the critical parameters that should be standardized when comparing YIF1B expression studies across different laboratories?

To ensure reproducibility and comparability of YIF1B expression studies across different laboratories, the following parameters should be standardized:

  • Sample Preparation Standards:

    • Tissue Collection and Processing:

      • Consistent euthanasia methods for rat models

      • Standardized brain region dissection procedures

      • Uniform post-mortem interval before tissue processing

      • Consistent flash-freezing protocols

    • Cell Culture Conditions:

      • Defined passage numbers for cell lines

      • Standardized culture media compositions

      • Consistent confluence levels at harvest

      • Validated mycoplasma testing

  • RNA Analysis Standardization:

    • Extraction Methods:

      • Consistent RNA isolation protocols

      • Standardized DNase treatment procedures

      • Uniform RNA quality assessment (RIN > 8)

    • RT-qPCR Standards:

      • Validated reference genes for normalization

      • Agreed-upon primer sequences and locations

      • Standard curve requirements for absolute quantification

      • Minimum technical and biological replicate numbers

  • Protein Analysis Standardization:

    • Extraction Protocols:

      • Defined lysis buffer compositions

      • Consistent membrane protein solubilization methods

      • Standardized fractionation procedures

    • Western Blot Parameters:

      • Validated antibodies with defined epitopes

      • Consistent loading controls

      • Standardized quantification methods

      • Linear dynamic range verification

  • Immunohistochemistry Standards:

    • Tissue Processing:

      • Consistent fixation protocols (duration, fixative composition)

      • Standardized antigen retrieval methods

      • Uniform blocking procedures

    • Antibody Parameters:

      • Validated primary antibodies with specificity controls

      • Consistent incubation conditions

      • Standardized detection systems

      • Quantification algorithms for signal intensity

  • Data Reporting Requirements:

    • Minimum Information Standards:

      • Complete methodological details for replication

      • Raw data availability

      • Detailed statistical analysis parameters

      • Positive and negative control results

    • Normalized Expression Formats:

      • Agreed units for relative expression

      • Standard reference samples for inter-lab calibration

      • Conversion factors between different quantification methods

Parameter CategoryCritical VariablesStandardization Approach
Animal ModelsAge, sex, strainAdopt ARRIVE guidelines
Cell CultureGrowth media, passage numberImplement detailed SOPs with quality control checkpoints
RNA AnalysisReference genes, primer efficiencyUse digital PCR for absolute quantification
Protein DetectionAntibody validation, loading controlsEmploy multiplexed assays with internal standards
ImagingAcquisition settings, analysis algorithmsDevelop open-source automated analysis pipelines

By implementing these standards, the research community can minimize lab-to-lab variation, enabling more reliable meta-analyses and accelerating scientific progress in understanding YIF1B function in rat models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.