Recombinant Rat Protein YIPF2 (Yipf2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Rat YIPF2 is expressed in mammalian cell systems to ensure proper post-translational modifications. Key parameters include:

ParameterDetails
Expression SystemMammalian cells (e.g., HEK293)
Purity>80% (verified by SDS-PAGE)
Endotoxin Levels<1.0 EU/μg (LAL method)
Storage-20°C to -80°C long-term; PBS buffer with 50% glycerol for short-term .

Custom production options are available for partial or full-length protein variants .

Research Applications

Recombinant YIPF2 has been instrumental in advancing studies across multiple fields:

Intracellular Trafficking

  • Regulates endocytic recycling of CD147 in HCC by acting as a Rab-GDF (GDI-displacement factor) for Rab5/Rab22a, modulating cell adhesion and invasion .

  • Enhances TNFRSF10B recycling to the plasma membrane in NSCLC, promoting chemotherapeutic agent-induced apoptosis .

Genome Stability

  • Depletion of YIPF2 increases DNA double-strand breaks (DSBs) and replication stress, impairing homologous recombination (HR) repair. Overexpression enhances DNA damage repair capacity and delays cellular senescence .

Biochemical Assays

  • Used in GST pull-down assays to study Rab GTPase interactions .

  • Applied in co-immunoprecipitation (co-IP) and flow cytometry to analyze protein trafficking dynamics .

Role in Cancer Biology

  • HCC: YIPF2 knockdown (KD) increases surface CD147, MMP secretion, and tumor cell invasion .

  • NSCLC: YIPF2 overexpression enhances TNFRSF10B-mediated apoptosis, correlating with improved patient survival in chemotherapy-treated cohorts .

DNA Repair Mechanisms

  • YIPF2 ensures HR repair efficiency by stabilizing BRCA1 and RAD51 recruitment. KD reduces HR repair activity by 40%, comparable to BRCA1 deficiency .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Yipf2; Protein YIPF2; YIP1 family member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Yipf2
Target Protein Sequence
MAAADDLAFHEFEEAANLLAETPDAATTSQSDKLTSQEHVAVVVGSGIGYGAEGEEEDDK TSLLQDEKPQPRFWTFDYYQSFFDVDTSQVLDRIKGSLLPHPGHNFVRHHLRNRPDLYGP FWICATLAFVLAVTGNLTLVLAQRRDPSIHYSPQFHKVTIAGITIYCYAWLVPLALWGFL RWRQGTRERMGLYTFLETVCVYGYSLFVFIPTVVLWLIPVQWLQWLFGALALALSAAGLV FTLWPVVREDTRLVAAALLSIVVLLHALLALGCKLYFFQPLPLDHVVPAPQAIPPSPNVL LPSSVQPMTTF
Uniprot No.

Target Background

Database Links
Protein Families
YIP1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane. Late endosome membrane.

Q&A

What is the molecular structure and localization of YIPF2?

YIPF2 belongs to the Yip1 domain family (YIPF) of proteins, which are multi-span transmembrane proteins primarily localized in the Golgi apparatus . These proteins typically contain five transmembrane helices with an N-terminal cytoplasmic region and a short C-terminal region facing the Golgi lumen . The transmembrane region, composed of multiple hydrophobic segments with scattered hydrophilic residues, is well conserved and formally annotated as the "Yip1 domain" in the Conserved Domain Database (CDD) . The YIPF protein structure typically features an odd number of transmembrane segments with the N-terminus exposed to the cytoplasm and C-terminus in the lumen .

What are the standardized nomenclature and identifiers for Rat YIPF2?

The standardized information for Rat YIPF2 includes:

Identifier TypeValue
Gene NamesYipf2; RGD1307512
Other NamesProtein YIPF2; Yip1 domain family, member 2
Gene ID363027
mRNA RefseqNM_001014208.1
Protein RefseqNP_001014230.1
UniProt IDQ5XIT3

This information is essential for accurate database searching and proper citation in research publications .

What is the primary cellular function of YIPF proteins?

YIPF proteins are proposed to function in vesicle budding and/or fusion processes at the Golgi apparatus . Interactome analyses have demonstrated that YIPF proteins form a core physical interaction network with selections of Ypt/Rab GTPases, connecting with other proteins functioning in membrane trafficking, including SNAREs and COPII components . These interactions suggest that YIPF proteins coordinate vesicle formation and trafficking between the endoplasmic reticulum and Golgi apparatus . Yip1p and Yif1p, yeast homologs of YIPF proteins, have been shown to recycle between the ER and Golgi, playing roles in both vesicle budding and fusion to coordinate vesicle flow between these organelles .

What expression systems are available for Recombinant Rat YIPF2 production?

Several expression systems can be employed for producing Recombinant Rat YIPF2:

Expression SystemApplicationTypical Purity
Mammalian CellsFull-length protein>80% by SDS-PAGE
Cell-Free ExpressionFull-length protein≥85% by SDS-PAGE
E. coli/Yeast/BaculovirusPartial protein≥85% by SDS-PAGE

The choice of expression system affects post-translational modifications and protein folding, which may impact functional studies . Mammalian expression systems are preferred when studying protein-protein interactions that require proper folding and post-translational modifications.

What are the optimal storage and handling conditions for Recombinant Rat YIPF2?

To maintain the integrity and activity of Recombinant Rat YIPF2:

Storage DurationRecommended TemperatureForm
Short-term+4°CLiquid in PBS buffer
Long-term-20°C to -80°CLyophilized powder or liquid

The protein is typically supplied in PBS buffer with endotoxin levels below 1.0 EU per μg as determined by the LAL method . Proper storage conditions are critical for maintaining protein stability and functionality for experimental applications.

How does YIPF2 contribute to genome integrity maintenance?

Recent research has uncovered an unexpected role for YIPF2 in maintaining genome stability . Depletion of YIPF2 results in:

  • Increased double-strand breaks (DSBs)

  • Impaired homologous recombination (HR) repair

  • Activation of DNA damage response pathways

  • Cellular senescence induction

Mechanistically, YIPF2 knockdown reduces levels of phosphorylated BRCA1, BACH1, and RAD51 (key HR repair proteins), while upregulating phosphorylated ATM and CHK2 (DNA damage sensors) . Using homology-directed repair GFP (HDR-GFP) reporter assays, YIPF2 knockdown reduced HR repair activity by approximately 40% compared to controls . These findings indicate that YIPF2 plays a critical role in the HR repair pathway essential for genome integrity.

How can researchers utilize YIPF2 overexpression in DNA damage studies?

YIPF2 overexpression provides a valuable experimental approach for studying DNA damage repair mechanisms . Researchers have demonstrated that:

  • YIPF2 overexpression reduces γH2A.X formation in senescent cells

  • It promotes repair of zeocin-induced DNA damage (quantifiable by comet assay)

  • The repair-enhancing effect is specific to the S phase of the cell cycle

  • It influences expression of DNA replication and cell cycle-related genes

This approach allows researchers to investigate the molecular mechanisms connecting Golgi function to DNA damage repair and potential applications in developing strategies against aging-related cellular dysfunction .

What is the relationship between YIPF2 and cell cycle-dependent DNA repair?

YIPF2 demonstrates cell cycle-specific effects on DNA repair processes . Experimental evidence shows:

Cell Cycle PhaseYIPF2 Effect on DNA RepairMethodology
S Phase (~10% of cells)Enhanced DNA damage repairEdU staining + zeocin treatment
G1 PhaseNo significant enhancementSerum starvation synchronization

This S phase specificity aligns with YIPF2's influence on homologous recombination, which primarily occurs during S phase when sister chromatids are available as repair templates . Additionally, YIPF2 regulates expression of MCM family proteins, CDC family proteins, and centromere proteins—all critical for DNA replication and cell cycle progression .

What methodological approaches are recommended for studying YIPF2's role in DNA repair?

Based on published research, several complementary techniques provide robust analysis of YIPF2's role in DNA repair:

  • RNA interference (siRNA/shRNA) for YIPF2 knockdown studies

  • Plasmid-based overexpression of tagged YIPF2

  • Immunoblotting for DNA repair proteins (BRCA1, RAD51, 53BP1, DNA-PKcs)

  • Immunofluorescence for DNA damage foci (γH2A.X)

  • Homology-directed repair reporter assays for quantitative HR assessment

  • Cell cycle synchronization by serum starvation/stimulation

  • Comet assay for direct measurement of DNA strand breaks

These approaches should be combined to establish mechanistic connections between YIPF2 function and DNA repair processes .

How can researchers distinguish between YIPF2's Golgi-related and DNA repair functions?

This question requires careful experimental design:

  • Use domain-specific mutants to separate membrane-binding from other functions

  • Employ subcellular fractionation to isolate Golgi-associated versus nuclear YIPF2

  • Perform rescue experiments with targeted YIPF2 variants

  • Use proximity labeling techniques (BioID/APEX) to identify compartment-specific interaction partners

  • Analyze temporal dynamics of YIPF2 localization after DNA damage induction

Current research suggests that an intact Golgi apparatus containing YIPF2 provides a protective effect on genome integrity, but the exact mechanism connecting these functions remains to be fully elucidated .

What are the key considerations when analyzing contradictory data regarding YIPF2 function?

When faced with seemingly contradictory results regarding YIPF2 function, researchers should consider:

  • Cell type-specific effects (different cell lines may exhibit varying YIPF2 dependencies)

  • Expression level variations (knockdown efficiency or overexpression levels)

  • Experimental timing (acute versus chronic YIPF2 depletion)

  • Indirect effects through Golgi dysfunction

  • Redundancy with other YIPF family members

  • Techniques used for measuring DNA damage (direct versus indirect markers)

  • Cell cycle distribution differences between experimental conditions

When analyzing published data, note that initial studies on yeast homologs yielded contradictory results regarding their roles in vesicle budding versus fusion, highlighting the complexity of YIPF protein functions .

How might YIPF2's dual role in membrane trafficking and genome integrity be integrated?

Integrating YIPF2's functions in both membrane trafficking and genome maintenance represents an exciting research frontier. Potential experimental approaches include:

  • Investigating whether DNA damage affects YIPF2-dependent trafficking

  • Determining if Golgi fragmentation during cell cycle or stress influences YIPF2's DNA repair function

  • Exploring whether YIPF2 directly shuttles between Golgi and nucleus during DNA damage

  • Examining how post-translational modifications regulate YIPF2's dual functions

  • Analyzing YIPF2 interactome changes during normal conditions versus DNA damage response

These investigations could reveal novel mechanisms connecting organelle function to genome maintenance .

What are the implications of YIPF2 research for understanding cellular senescence and aging?

YIPF2's role in preventing DNA damage-induced senescence suggests several potential aging-related research directions:

  • Characterizing YIPF2 expression changes during replicative and stress-induced senescence

  • Investigating how age-related Golgi dysfunction might impact YIPF2-dependent DNA repair

  • Examining YIPF2 polymorphisms in relation to human longevity or age-related diseases

  • Developing interventions targeting YIPF2 to enhance DNA repair in senescent cells

  • Exploring connections between YIPF2 and other senescence-associated secretory phenotype (SASP) regulators

Understanding these connections could help develop strategies to combat aging by maintaining genome integrity .

What are common challenges in working with Recombinant Rat YIPF2 and their solutions?

Researchers working with Recombinant Rat YIPF2 may encounter several technical challenges:

ChallengePotential Solution
Low protein solubilityUse detergent-containing buffers appropriate for membrane proteins
Aggregation during storageAliquot and store at -80°C with glycerol as cryoprotectant
Inconsistent activityVerify proper folding through circular dichroism or limited proteolysis
Difficulty detecting interactionsUse membrane-compatible interaction assays (split-ubiquitin or BRET)
Variable knockdown effectsTest multiple siRNA sequences and validate protein reduction

These technical considerations are critical for generating reproducible results when studying this multi-transmembrane protein .

How can researchers validate antibody specificity for YIPF2 detection?

Proper antibody validation is essential for reliable YIPF2 detection:

  • Perform YIPF2 knockdown/knockout controls

  • Test antibody recognition of recombinant YIPF2 by Western blot

  • Compare multiple antibodies targeting different epitopes

  • Include appropriate blocking peptides

  • Verify subcellular localization pattern against known Golgi markers

  • Consider tagged YIPF2 constructs when antibody specificity is questionable

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.