Recombinant Rat Protein YIPF4 (Yipf4)

Shipped with Ice Packs
In Stock

Description

Product Overview of Recombinant Rat YIPF4 Protein

Recombinant Rat YIPF4 (Yip1 domain family, member 4) is a bioengineered protein expressed in mammalian cells, designed for research applications in cell biology, autophagy, and Golgi apparatus studies. Key specifications include:

ParameterDetail
SourceMammalian cells (e.g., HEK293)
TagHis-tag for purification and detection
FormLiquid (PBS buffer) or lyophilized powder
Purity>80% (SDS-PAGE confirmed)
Endotoxin Level<1.0 EU/μg (LAL method)
StorageShort-term: +4°C; Long-term: -20°C to -80°C
Gene ID362699 (Rattus norvegicus)
UniProt IDQ5M7T4

This recombinant protein is produced via custom synthesis, with a lead time of 5–9 weeks. It is not approved for human consumption .

Biological Function of YIPF4

YIPF4 is a five-transmembrane protein localized to the cis-Golgi and forms a heterodimer with YIPF3. Together, they regulate:

  • Golgiphagy: Selective autophagy of Golgi fragments under starvation conditions .

  • Golgi Maintenance: Prevents Golgi fragmentation and structural disruption .

  • ER-to-Golgi Trafficking: May assist in vesicle transport .

Key Mechanisms

  1. Golgiphagy Receptor: The YIPF3-YIPF4 complex binds LC3B, GABARAP, and GABARAPL1 via YIPF3’s LIR (LC3-interacting region) motif. This interaction is phosphorylation-dependent .

  2. Stability Regulation: YIPF4 stabilizes YIPF3; knockdown of either protein leads to Golgi fragmentation .

  3. Post-Translational Modifications: YIPF3 undergoes N-glycosylation (40 kDa), O-glycosylation (46 kDa), and C-terminal cleavage (36 kDa) .

Golgiphagy Regulation

  • Reporter Systems: mRFP–EGFP–Golgi and Halo–mGFP–Golgi systems demonstrated that YIPF4 knockdown reduces Golgiphagy flux by 50–70% under starvation .

  • LIR Motif Dependency: Mutation of YIPF3’s LIR motif (e.g., LIR2A_1) abolishes LC3 binding and Golgiphagy .

  • Phosphorylation Requirement: Phosphorylation of serine residues upstream of the LIR motif (positions −2 and −1) mimics TEX264’s ER-phagy mechanism .

Applications in Research

ApplicationDetails
Gene ExpressionStudied in thyroid, adipose, and liver tissues .
Chemical InteractionsModulated by aflatoxin B1, tetrachlorodibenzodioxin, and nicotine .
Disease ModelsLinked to tarsal-carpal coalition syndrome and proximal symphalangism .
Autophagy StudiesUsed to investigate Golgi degradation pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Yipf4; Protein YIPF4; YIP1 family member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Yipf4
Target Protein Sequence
MQPPGPPPAYAPANGDFTFVSSADAEDLSGSIAAPDVKLNLGVSGDFIKESTATTFLRQR GYGWLLEVEDEDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGP LAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPL IVIAPILLVVGSFEMVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFL SLYTGV
Uniprot No.

Target Background

Function
Yipf4 plays a role in maintaining the structure of the Golgi apparatus.
Database Links
Protein Families
YIP1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is YIPF4 and what cellular compartment does it localize to?

YIPF4 (Yip1 Domain Family Member 4) is a five-pass transmembrane protein primarily localized to the cis-Golgi network membrane . It forms a complex with YIPF3, and together they function as integral components of the Golgi apparatus. YIPF4 has a specific topology with cytoplasmic (residues 1-113, 160-166, 217-223), helical (residues 114-134, 139-159, 167-187, 196-216, 224-244), and extracellular (residues 135-138, 188-195) domains . For effective localization studies, immunofluorescence experiments using antibodies against both YIPF4 and established Golgi markers (such as GM130) are recommended to confirm proper localization in your experimental system.

What is the primary function of YIPF4 in cellular homeostasis?

YIPF4 primarily functions in maintaining Golgi structure and participates in the process of Golgiphagy (selective autophagy of the Golgi apparatus) . Recent research has established that the YIPF3-YIPF4 complex serves as a Golgiphagy receptor, regulating the turnover of Golgi fragments through autophagy, particularly during nutrient stress conditions . Methodologically, this function has been demonstrated through various approaches including knockout studies, fluorescent reporter assays, and colocalization experiments with autophagy markers like LC3.

How do YIPF3 and YIPF4 interact to form a functional complex?

The YIPF3-YIPF4 complex forms through specific protein-protein interactions, with YIPF4 playing a crucial role in stabilizing YIPF3 . Research indicates that depletion of YIPF4 results in reduced YIPF3 levels, suggesting YIPF4 is essential for YIPF3 stability . This interaction has been confirmed through co-immunoprecipitation experiments and colocalization studies showing that EGFP-tagged YIPF4 colocalizes with endogenous YIPF3 in cellular systems . When designing experiments to study this complex, researchers should consider the interdependence of these proteins and use approaches that can detect both components simultaneously.

What are the most effective methods for studying YIPF4 localization and trafficking?

For studying YIPF4 localization and trafficking, multiple complementary approaches are recommended:

  • Immunofluorescence microscopy: Using antibodies against YIPF4 and Golgi markers (GM130, GRASP65, golgin84) to visualize colocalization .

  • Cell fractionation analysis: Nycodenz density gradient centrifugation has been successfully employed to separate cellular compartments and detect YIPF4 in Golgi-enriched fractions .

  • Live-cell imaging: Expressing fluorescent protein-tagged YIPF4 (such as EGFP-YIPF4) allows monitoring of YIPF4 dynamics in real time .

  • Electron microscopy: For ultrastructural localization, immunogold labeling can reveal YIPF4 distribution relative to Golgi cisternae and associated vesicles .

When designing these experiments, consider using multiple markers representing different Golgi compartments (cis-, medial-, and trans-Golgi) to precisely map YIPF4 distribution.

What reporter systems are available for studying YIPF4-mediated Golgiphagy?

Two novel reporter systems have been developed specifically for studying Golgiphagy involving the YIPF3-YIPF4 complex:

  • mRFP-EGFP-Golgi reporter system: This tandem fluorescent tag approach exploits the differential sensitivity of EGFP and mRFP to lysosomal pH. Before fusion with lysosomes, both mRFP and EGFP signals are visible. After fusion, only mRFP signals remain, allowing quantification of Golgiphagy flux by measuring mRFP-only positive structures .

  • Halo-mGFP-Golgi reporter-processing assay: This system uses the Halo tag that becomes resistant to lysosomal proteolysis upon ligand binding. When Halo-mGFP-Golgi is delivered to lysosomes via autophagy, a free Halo tag (33 kDa) is generated. The appearance of this free tag can be quantified by SDS-PAGE, providing a biochemical measurement of Golgiphagy .

Both systems have been validated using autophagy inhibitors (Bafilomycin A1) and in autophagy-deficient cells (FIP200-KO), confirming their specificity for autophagy-dependent Golgi turnover .

What genetic manipulation approaches are most suitable for studying YIPF4 function?

Several genetic approaches have proven effective for studying YIPF4 function:

  • CRISPR-Cas9 gene editing: Generation of YIPF4-KO cell lines allows investigation of loss-of-function phenotypes . When using this approach, it's important to verify knockout efficiency through both protein detection and functional assays.

  • siRNA-mediated knockdown: Transient depletion using siRNA targeting bases 503-523 of the YIPF4 sequence has achieved approximately 80% knockdown efficiency . This approach is useful for studying acute effects without potential compensatory mechanisms that may develop in stable knockouts.

  • Overexpression studies: Stable expression of tagged YIPF4 constructs (EGFP-YIPF4, FLAG-HA-YIPF4) has been used to study gain-of-function effects and for protein interaction analyses .

  • Site-directed mutagenesis: Mutating specific domains or motifs within YIPF4 can help elucidate structure-function relationships .

When implementing these approaches, careful consideration should be given to potential off-target effects and validation through rescue experiments.

How does the YIPF3-YIPF4 complex function as a Golgiphagy receptor?

The YIPF3-YIPF4 complex serves as a selective autophagy receptor for Golgi degradation through specific interactions with autophagy machinery:

  • LC3/GABARAP binding: YIPF3 contains a LC3-interacting region (LIR) motif that directly binds to LC3B, GABARAP, and GABARAPL1 . This interaction is critical for targeting Golgi fragments to autophagosomes.

  • Phosphorylation-dependent regulation: The LIR motif in YIPF3 requires phosphorylation of serine residues (positions -2 and -1) immediately upstream of the LIR for efficient interaction with ATG8 proteins . This phosphorylation creates multiple hydrogen bonds with ATG8 proteins, similar to what has been observed for the ER-phagy receptor TEX264 .

  • Structural basis: Computational models using AlphaFold-Multimer have revealed that the YIPF3 LIR motif docks with the β-sheet of GABARAPL1, with side chains of Phe47 and Met50 inserted into hydrophobic pockets .

For studying these interactions experimentally, researchers should consider using phosphomimetic mutations (S to D/E) or phospho-specific antibodies to investigate the role of phosphorylation in YIPF3-ATG8 binding.

How can YIPF4-mediated Golgiphagy be quantitatively measured?

Quantitative measurement of YIPF4-mediated Golgiphagy can be achieved through multiple complementary approaches:

  • Fluorescence microscopy quantification:

    • Count mRFP-only positive puncta in cells expressing the mRFP-EGFP-Golgi reporter

    • Calculate the ratio of mRFP-only to total (mRFP+EGFP) puncta

    • Compare between control and experimental conditions

  • Biochemical quantification:

    • Measure the generation of free Halo tag (33 kDa) from Halo-mGFP-Golgi by SDS-PAGE

    • Calculate the ratio of free Halo to total Halo-tagged protein

    • Compare between nutrient-rich and starvation conditions

  • Proteomic approach:

    • Perform quantitative proteomics to measure levels of Golgi proteins in wild-type versus autophagy-deficient cells

    • Focus on changes that occur specifically during nutrient stress

  • Western blot analysis:

    • Monitor degradation of Golgi markers in the presence or absence of autophagy inhibitors (Bafilomycin A1)

    • Compare between YIPF4-KO and wild-type cells

For all these methods, appropriate controls should include autophagy inhibitors (Bafilomycin A1) and autophagy-deficient cells (ATG5-KO or FIP200-KO) to confirm the specificity of the observed effects.

How does phosphorylation regulate the function of the YIPF3-YIPF4 complex?

Phosphorylation plays a critical role in regulating YIPF3-YIPF4 complex function, particularly through its effect on the interaction with autophagy machinery:

  • LIR motif phosphorylation: The serine residues (positions -2 and -1) immediately upstream of the YIPF3 LIR motif require phosphorylation for efficient binding to ATG8 family proteins . This mechanism is similar to that observed for TEX264, an ER-phagy receptor.

  • Structural implications: Computational modeling and experimental evidence suggest that phosphorylated serine residues form hydrogen bonds with His9, Arg47, and Lys48 of GABARAPL1, significantly enhancing binding affinity .

  • Experimental strategies:

    • Use phospho-mimetic mutations (S→D or S→E) to study the role of phosphorylation

    • Apply phospho-specific antibodies to detect phosphorylated forms of YIPF3

    • Identify kinases responsible for YIPF3 phosphorylation through kinase inhibitor screening or kinase overexpression

  • Regulation in response to stress: Investigate whether nutrient starvation or other cellular stresses increase YIPF3 phosphorylation to promote Golgiphagy

These approaches can help elucidate the dynamic regulation of the YIPF3-YIPF4 complex and its role in maintaining Golgi homeostasis under various conditions.

What are the implications of YIPF4 dysfunction for cellular homeostasis and disease?

While direct disease associations with YIPF4 dysfunction remain limited in the current literature, several implications can be drawn from its cellular functions:

  • Golgi morphology alterations: Expression of YIPF3 LIR motif mutants leads to elongated Golgi morphology, suggesting that disruption of YIPF3-YIPF4-mediated Golgiphagy affects Golgi structure . This could potentially impact protein trafficking, post-translational modifications, and secretion.

  • Autophagy dysfunction: As the YIPF3-YIPF4 complex is crucial for selective autophagy of the Golgi, its dysfunction might contribute to broader autophagy-related pathologies, including neurodegenerative diseases and cancer.

  • Stress response impairment: The complex appears particularly important during nutrient stress , suggesting that YIPF4 dysfunction might compromise cellular adaptation to metabolic challenges.

  • Research approaches:

    • Investigate tissue-specific expression and function of YIPF4 in different physiological and pathological contexts

    • Examine potential genetic variations in YIPF4 and their correlation with disease phenotypes

    • Study the consequences of YIPF4 dysfunction in the context of specific disease models

These investigations could provide new insights into the role of Golgi quality control in health and disease.

How should researchers interpret conflicting data regarding YIPF4 function?

When encountering conflicting data on YIPF4 function, consider the following analytical approaches:

  • Contextual differences:

    • Cell type specificity: YIPF4 function may vary between different cell types or tissues

    • Experimental conditions: Nutrient status, stress conditions, and growth phase can affect YIPF4 behavior

    • Expression levels: Overexpression versus endogenous expression may yield different results

  • Methodological considerations:

    • Knockout versus knockdown: Complete absence (KO) may trigger compensatory mechanisms not seen with partial depletion (KD)

    • Acute versus chronic depletion: Temporary siRNA-mediated knockdown may have different effects than stable knockout

    • Tag interference: Different tags (EGFP, mRFP, Halo) may differentially affect protein function

  • Interaction networks:

    • YIPF3 dependence: Since YIPF4 functions in complex with YIPF3, differences in YIPF3 status between experimental systems could explain contradictory results

    • Additional binding partners: Variation in expression of other interaction partners could influence outcomes

  • Analytical approach:

    • Perform complementary assays to validate findings

    • Consider dose-dependency and kinetic aspects

    • Explicitly test alternative hypotheses that could reconcile conflicting data

For example, while one study reported that YIPF4 depletion doesn't affect EGFR expression , this may not contradict its role in Golgi homeostasis , as these functions may be context-dependent or involve different molecular pathways.

What are common technical challenges when working with recombinant YIPF4 and how can they be addressed?

ChallengePotential SolutionsValidation Methods
Poor expression of recombinant YIPF4- Optimize codon usage for expression system
- Use solubility-enhancing tags (MBP, SUMO)
- Express truncated domains rather than full-length protein
- Western blot
- Coomassie staining
- Fluorescence detection
Improper localization of tagged YIPF4- Test different tag positions (N vs C-terminal)
- Use smaller tags that minimize interference
- Include flexible linkers between tag and protein
- Colocalization with endogenous YIPF4
- Colocalization with Golgi markers
- Functional complementation assays
Instability of YIPF4 without YIPF3- Co-express YIPF3 and YIPF4
- Use stabilizing mutations
- Express in cells with endogenous YIPF3
- Half-life measurements
- Pulse-chase experiments
- Protein aggregation assays
Difficulty detecting protein interactions- Use crosslinking approaches
- Optimize buffer conditions
- Consider membrane-compatible detergents
- Co-immunoprecipitation
- Proximity ligation assay
- FRET or BiFC assays
Variable results in Golgiphagy assays- Standardize starvation conditions
- Include positive controls (known autophagy inducers)
- Use multiple independent assays
- Parallel measurement with different reporters
- Confirmation with pharmacological modulators
- Internal controls for cell viability

When working with recombinant YIPF4, it's particularly important to consider its transmembrane nature and dependence on YIPF3 for stability . Strategies that account for these characteristics will increase the likelihood of successful experimental outcomes.

What are promising areas for future investigation of YIPF4 function?

Several promising research directions could significantly advance our understanding of YIPF4 biology:

  • Regulatory mechanisms of Golgiphagy:

    • Identify signaling pathways that activate YIPF3-YIPF4-mediated Golgiphagy

    • Characterize kinases responsible for YIPF3 LIR motif phosphorylation

    • Investigate how nutrient sensing mechanisms connect to YIPF3-YIPF4 activity

  • Structural biology approaches:

    • Determine the high-resolution structure of the YIPF3-YIPF4 complex

    • Map the interaction interface between YIPF3-YIPF4 and ATG8 proteins

    • Develop structure-based modulators of YIPF3-YIPF4 function

  • Physiological and pathological relevance:

    • Examine the role of YIPF3-YIPF4 in tissue-specific Golgi homeostasis

    • Investigate potential implications in neurodegenerative diseases and cancer

    • Develop animal models with conditional knockout of YIPF4

  • Integration with other cellular processes:

    • Explore connections between Golgiphagy and ER-phagy, given similarities between YIPF3 and TEX264

    • Investigate how YIPF4 function intersects with conventional secretory pathways

    • Study the relationship between Golgiphagy and unconventional protein secretion

These research directions could be pursued using emerging technologies like proximity labeling proteomics, CRISPR screens, and in vivo imaging approaches to gain comprehensive insights into YIPF4 biology.

How might therapeutic targeting of the YIPF3-YIPF4 complex be approached?

While therapeutic applications remain speculative at this stage, several approaches could be considered for targeting the YIPF3-YIPF4 complex:

  • Modulation of Golgiphagy:

    • Develop compounds that enhance YIPF3-YIPF4-mediated Golgiphagy to promote Golgi quality control

    • Design inhibitors that block excessive Golgiphagy in contexts where it might be detrimental

    • Target the phosphorylation state of YIPF3 to regulate its activity

  • Peptide-based approaches:

    • Design cell-permeable peptides that mimic or block the YIPF3 LIR motif

    • Develop stabilized peptides that can modulate YIPF3-YIPF4 complex formation

  • Gene therapy considerations:

    • Investigate cell-type specific expression of YIPF4 to enable targeted interventions

    • Explore viral vector-based delivery of YIPF4 variants in deficiency contexts

  • Biomarker potential:

    • Evaluate whether YIPF3-YIPF4 levels or activity correlate with disease states

    • Develop assays to monitor Golgiphagy as a potential biomarker for cellular stress

These therapeutic approaches would need to be preceded by extensive validation of YIPF4's role in specific disease contexts, which remains an important area for future investigation.

What novel methodologies are being developed to study YIPF4 and Golgiphagy?

Recent methodological advances have significantly enhanced our ability to study YIPF4 and Golgiphagy:

  • Reporter systems:

    • The mRFP-EGFP-Golgi and Halo-mGFP-Golgi reporter systems represent major innovations for quantitative assessment of Golgiphagy

    • These systems can be readily adapted to high-content screening approaches for identifying modulators of YIPF4 function

  • Proteomic approaches:

    • Quantitative proteomics comparing ATG5-deficient and wild-type tissues has successfully identified YIPF3 and YIPF4 as autophagy substrates

    • Proximity labeling methods (BioID, APEX) can map the local interactome of YIPF4 within the Golgi membrane

  • Computational modeling:

    • AlphaFold-Multimer has been applied to predict interactions between the YIPF3-YIPF4 complex and ATG8 proteins

    • This approach can be extended to model additional protein interactions and predict effects of mutations

  • Live-cell imaging techniques:

    • Advanced microscopy methods combining multiple fluorescent reporters allow simultaneous visualization of Golgi dynamics and autophagy

    • These approaches can reveal the spatiotemporal regulation of YIPF4-mediated processes

These methodological advances provide researchers with powerful tools to investigate YIPF4 biology with unprecedented precision and throughput.

How can researchers optimize experimental design for studying YIPF4 in different model systems?

Model SystemExperimental ConsiderationsAdvantagesLimitations
Cell Culture Systems- Choose cell types with appropriate Golgi morphology
- Consider endogenous YIPF3/YIPF4 expression levels
- Include both nutrient-rich and starvation conditions
- Easily manipulated genetically
- Compatible with live imaging
- Cost-effective for screening
- May not recapitulate tissue-specific functions
- Immortalized cells may have altered Golgi dynamics
Primary Cells- Isolate from relevant tissues (neurons, hepatocytes)
- Verify expression of YIPF3/YIPF4
- Optimize transfection protocols for primary cells
- More physiologically relevant
- Retain tissue-specific characteristics
- Better reflect in vivo regulation
- Limited lifespan
- More challenging to manipulate
- Higher variability between preparations
Organoids- Develop 3D culture systems with proper Golgi organization
- Implement compatible imaging approaches
- Consider cell-type heterogeneity within organoids
- Recapitulate tissue architecture
- Allow study of cell-cell interactions
- Bridge gap between 2D culture and in vivo
- Technical complexity
- Variability between organoid batches
- Challenges in genetic manipulation
Animal Models- Generate conditional knockout models
- Consider tissue-specific effects
- Develop in vivo imaging approaches
- Study physiological functions
- Evaluate systemic effects
- Identify tissue-specific phenotypes
- Higher cost and time investment
- Potential compensatory mechanisms
- Ethical considerations

For any chosen model system, researchers should implement appropriate controls, including:

  • Positive controls for Golgiphagy induction (starvation, specific inducers)

  • Autophagy-deficient controls (ATG5-KO, FIP200-KO cells/tissues)

  • Rescue experiments with wild-type versus mutant YIPF4 constructs

These experimental design considerations will help ensure robust and reproducible findings across different model systems .

How does understanding YIPF4 contribute to the broader field of organelle homeostasis?

The study of YIPF4 and its role in Golgiphagy provides several important contributions to our understanding of organelle homeostasis:

  • Expansion of selective autophagy mechanisms: The identification of the YIPF3-YIPF4 complex as the first Golgiphagy receptor fills a significant gap in our understanding of how different organelles are selectively targeted for autophagic degradation.

  • Common principles across organelle-specific autophagy: The striking similarity between the phosphorylation-dependent LIR motif in YIPF3 and the ER-phagy receptor TEX264 suggests shared regulatory mechanisms across different types of selective autophagy.

  • Golgi quality control: YIPF4-mediated Golgiphagy represents an important quality control mechanism for maintaining Golgi integrity and function, complementing other known quality control systems for mitochondria, ER, and peroxisomes.

  • Integration of stress responses: The activation of Golgiphagy during nutrient stress illustrates how cellular architecture is dynamically remodeled to adapt to changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.