Recombinant Rat Proteinase-activated receptor 1 (F2r)

Shipped with Ice Packs
In Stock

Description

Definition and Overview of Recombinant Rat Proteinase-Activated Receptor 1 (F2r)

Recombinant Rat Proteinase-Activated Receptor 1 (F2r), also known as PAR-1 or thrombin receptor, is a synthetic, laboratory-produced version of the endogenous G-protein-coupled receptor (GPCR) encoded by the F2r gene. This recombinant protein is engineered to mimic the structure and function of native PAR1, which plays critical roles in thrombosis, inflammation, and cellular signaling. It is widely used in research to study PAR1-mediated pathways, including coagulation, vascular regulation, and disease mechanisms like fibrosis and osteoclastogenesis .

Production and Applications

Recombinant F2r is produced via bacterial expression systems (e.g., E. coli) and purified using affinity chromatography. Its applications span basic research, drug development, and diagnostic assays:

Research Applications

ApplicationExample Use CasesSource
Thrombosis StudiesInvestigating platelet activation and endothelial barrier integrity
OsteoclastogenesisStudying PAR1’s role in modulating Notch2 signaling during bone resorption
Fibrosis ModelsExamining PAR1’s interaction with TGF-β and Smad2 pathways in renal injury
ELISA DevelopmentDetecting F2r levels in rodent serum, plasma, or cell lysates

4.1. Role in Osteoclastogenesis

PAR1 deletion in mice enhances osteoclast formation via increased Notch2 signaling. In vitro studies show:

  • RANKL + TNF: PAR1-deficient myeloid cells exhibit 2–3-fold higher osteoclastogenesis than wild-type .

  • Mechanism: PAR1 inhibits Notch2 signaling by reducing its receptor activity-modifying protein (RAMP) interactions, thereby limiting osteoclast differentiation .

4.2. Fibrosis and TGF-β Signaling

PAR1 activation in renal tubular cells synergizes with TGF-β to induce:

  • CTGF Expression: Connective tissue growth factor (CTGF) upregulation via Smad2/3 phosphorylation .

  • Pathway Crosstalk: PAR1 transactivates EGF receptor (EGFR) and TGF-β receptor (TGFβR) signaling, promoting fibrotic gene expression .

4.3. Antagonist Development

Small-molecule antagonists like RWJ-56110 and FR17113 block thrombin-induced PAR1 activation in platelets and vascular smooth muscle cells . These compounds inhibit calcium mobilization and ERK1/2 activation, offering therapeutic potential for cardiovascular diseases .

Experimental Considerations

ParameterDetailsSource
Storage-20°C/-80°C (lyophilized); avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability
Activity AssaysCalcium flux, MAP kinase phosphorylation, or receptor internalization assays

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
F2r; Par1; Proteinase-activated receptor 1; PAR-1; Thrombin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-432
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
F2r
Target Protein Sequence
SFFLRNPSEDTFEQFPLGDEEEKNESIPLEGRAVYLNKSRFPPMPPPPFISEDASGYLTS PWLTLFIPSVYTFVFIVSLPLNILAIAVFVFRMKVKKPAVVYMLHLAMADVLFVSVLPFK ISYYFSGTDWQFGSGMCRFATAACYCNMYASIMLMTVISIDRFLAVVYPIQSLSWRTLGR ANFTCVVIWVMAIMGVVPLLLKEQTTQVPGLNITTCHDVLNETLLHGFYSYYFSAFSAIF FLVPLIISTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVHYL LLSDSPGTETAYFAYLLCVCVTSVASCIDPLIYYYASSECQKHLYSILCCRESSDSNSCN STGQLMPSKMDTCSSHLNNSIYKKLLA
Uniprot No.

Target Background

Function

High-affinity receptor for activated thrombin; coupled to G proteins that stimulate phosphoinositide hydrolysis.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Proteinase-Activated Receptor 1 (F2r) and how does it function?

Proteinase-Activated Receptor 1 (PAR1), encoded by the F2r gene, is a G protein-coupled receptor that functions through a unique activation mechanism. Unlike conventional receptors, PAR1 is activated when proteases cleave its N-terminal extracellular domain, exposing a tethered ligand sequence. This newly exposed N-terminal domain alters its conformation and binds to a specific sequence within the extracellular region of PAR1, triggering signaling cascades . Different proteases can unmask various ligand domains, producing a spectrum of cellular responses. In bone biology, PAR1 is transiently expressed during osteoclast precursor differentiation but is notably absent in mature osteoclasts .

Where is PAR1 expressed in rat tissues and at what developmental stages?

In developing rat bones, PAR1 has been identified through immunohistochemistry in several cell types including osteoblasts, macrophages, muscle cells, and endothelial cells. Importantly, mature osteoclasts show no expression of PAR1, suggesting its role is primarily in precursor or developing cells rather than in terminally differentiated osteoclasts . This expression pattern indicates PAR1 likely functions in early cellular differentiation processes rather than in mature cell maintenance.

What are the optimal methods for detecting rat PAR1 protein in experimental samples?

For quantitative detection of rat PAR1 protein, sandwich enzyme-linked immunosorbent assay (ELISA) is the recommended approach. Commercial ELISA kits for rat PAR1 typically offer detection ranges of 0.156-10 ng/ml with sensitivity below 0.07 ng/ml . The assay principle involves:

  • Pre-coating of antibody onto a 96-well plate

  • Addition of standards, samples, and biotin-conjugated reagent

  • Incubation with HRP-conjugated reagent

  • Detection using TMB substrate, which produces a blue-colored product in wells containing PAR1

  • Addition of acidic stop solution, changing the color to yellow

  • Measurement of optical density at 450 nm using a microplate reader

The intensity of the yellow color is proportional to the amount of PAR1 bound on the plate . For specific research applications, Western blotting, immunoprecipitation, and immunohistochemistry can also be utilized to detect PAR1 expression in different cellular contexts.

How should recombinant rat PAR1 protein be properly stored and reconstituted?

Recombinant proteins should be handled according to manufacturer specifications, but general guidelines include:

  • Storage: Store lyophilized protein at 2-8°C for short-term (one month) or aliquot and store at -80°C for long-term (12 months)

  • Reconstitution: Reconstitute in sterile PBS (pH 7.2-7.4)

  • Stability: Avoid repeated freeze/thaw cycles as they can significantly decrease protein activity

  • Quality control: Proteins typically come with >95% purity as determined by SDS-PAGE

The stability of properly stored recombinant proteins is typically characterized by a loss rate of less than 5% within the expiration date under appropriate storage conditions .

What in vitro models are best suited for studying PAR1 function in osteoclastogenesis?

Based on published methodologies, the following in vitro model is recommended for studying PAR1 function in osteoclastogenesis:

  • Isolation of bone marrow macrophages (BMMs) from wild-type and PAR1 KO mice

  • Culture in the presence of M-CSF (30 ng/ml) and RANKL (30 ng/ml) to induce osteoclast differentiation

  • Treatment with specific antibodies or inhibitors as required (e.g., anti-Notch2-NRR antibody at 10 μg/ml)

  • Culture for 5 days to allow formation of multinucleated osteoclasts

  • Quantification of multinucleated, TRAP-positive cells

This model allows for direct comparison between wild-type and PAR1-deficient osteoclast precursors, revealing the role of PAR1 in regulating osteoclast formation under various conditions.

How does PAR1 deletion affect osteoclast formation in response to inflammatory cytokines?

PAR1 deletion significantly enhances osteoclastogenic responses to inflammatory cytokines. Specifically:

  • PAR1 KO myeloid cells demonstrate enhanced osteoclastogenesis in response to RANKL alone or the combination of RANKL and TNF in vitro

  • In vivo osteoclastogenic responses to TNF are markedly enhanced in PAR1 KO mice

  • The enhanced osteoclastogenesis in PAR1 KO cells can be reduced to wild-type levels by inhibiting Notch2 signaling using anti-Notch2-NRR antibody

These findings indicate that PAR1 functions as a negative regulator of osteoclastogenesis, particularly in inflammatory conditions, by limiting Notch2 signaling pathways. This effect appears to be cell-autonomous, as it is observed in highly purified PAR1 KO osteoclast precursor cells .

What is the relationship between PAR1 and Notch2 signaling in osteoclast differentiation?

PAR1 functions to limit Notch2 signaling during osteoclast differentiation, particularly in response to RANKL and TNF stimulation. The following observations support this relationship:

  • Treatment with anti-Notch2-NRR antibody reduces TNF-induced osteoclastogenesis in PAR1 KO mice to wild-type levels without affecting wild-type responses

  • Similarly, in vitro application of anti-Notch2-NRR antibody reduces RANKL-induced osteoclastogenesis in PAR1 KO cells to wild-type levels without altering wild-type responses

This suggests that the enhanced osteoclastogenesis observed in PAR1-deficient cells is mediated through increased Notch2 signaling, and inhibition of this pathway can normalize the osteoclastogenic potential of PAR1 KO cells.

How can PAR1 expression be experimentally manipulated in osteoclast precursors?

To manipulate PAR1 expression in osteoclast precursor studies, researchers can employ several approaches:

  • Genetic models: Utilize PAR1 KO mice (available from Jackson Laboratory, Stock No: 002862) for complete deletion studies

  • siRNA or shRNA: For transient knockdown of PAR1 expression in cell culture models

  • CRISPR-Cas9 genome editing: For generating stable cell lines with PAR1 deletion or modification

  • Overexpression systems: Transfection with PAR1-expressing vectors to study the effects of increased receptor levels

  • Pharmacological modulators: PAR1-specific agonists or antagonists can be used to modulate receptor activity without altering expression levels

For studying transient PAR1 induction during osteoclastogenesis, time-course experiments with M-CSF and RANKL treatment followed by protein or transcript quantification are recommended .

How does PAR1 signaling interact with other inflammatory pathways in bone metabolism?

PAR1 signaling intersects with inflammatory pathways in bone metabolism through several mechanisms:

  • TNF signaling: PAR1 deletion enhances osteoclastogenic responses to TNF stimulation, indicating that PAR1 normally functions to dampen TNF-induced osteoclastogenesis

  • RANKL signaling: PAR1 KO cells show enhanced responses to RANKL, suggesting PAR1 negatively regulates RANKL-induced osteoclast formation

  • Notch2 pathway: PAR1 appears to limit Notch2 signaling during inflammatory stimulation, as inhibition of Notch2 normalizes the enhanced osteoclastogenesis in PAR1 KO cells

  • NF-κB activation: PAR1 may influence nuclear translocation of NF-κB components following RANKL stimulation, as suggested by studies examining cytoplasmic and nuclear fractions of stimulated cells

These interactions position PAR1 as a potential regulatory node in inflammatory bone loss, making it a promising target for therapeutic intervention in inflammatory bone diseases.

What are the differences in PAR1 signaling between rat and human models?

While the search results do not provide direct comparisons between rat and human PAR1 signaling, researchers should consider several important factors when translating findings between species:

  • Sequence homology: Although PAR1 is conserved across mammalian species, subtle differences in protein sequence may affect ligand binding, activation mechanisms, or downstream signaling

  • Expression patterns: The tissue-specific expression patterns of PAR1 may vary between rats and humans

  • Signaling partners: The availability and function of PAR1 signaling partners may differ between species

  • Pharmacological responses: Responses to PAR1 agonists or antagonists may vary between rat and human PAR1 due to structural differences

How can PAR1-mediated signaling be quantified in experimental settings?

Several methodological approaches can be employed to quantify PAR1-mediated signaling:

  • Nuclear translocation assays: Following RANKL stimulation, cells can be fractionated into cytoplasmic and nuclear components to measure the nuclear translocation of transcription factors like NF-κB

  • Phosphorylation status: Western blotting for phosphorylated signaling proteins (e.g., p38 MAPK, ERK, JNK) can indicate activation of PAR1-dependent pathways

  • Calcium flux: As a G protein-coupled receptor, PAR1 activation often triggers calcium release, which can be measured using calcium-sensitive fluorescent dyes

  • Gene expression analysis: Quantitative PCR for PAR1-regulated genes provides an indirect measure of signaling activity

  • Reporter assays: Cells transfected with pathway-specific reporter constructs (e.g., NF-κB, NFAT) can reveal PAR1-mediated activation of specific transcriptional programs

These techniques allow researchers to quantitatively assess PAR1 signaling activity and its modulation by various experimental conditions.

What are common challenges in working with recombinant PAR1 proteins?

Researchers working with recombinant PAR1 proteins may encounter several challenges:

  • Protein stability: PAR1 is susceptible to degradation, with manufacturers noting that proper storage is crucial to maintain less than 5% loss rate within the expiration date

  • Reconstitution issues: Improper reconstitution may lead to protein aggregation or loss of activity

  • Batch variation: Different production batches may show slight variations in activity

  • Purity concerns: Ensuring >95% purity is essential for experimental reproducibility

  • Functional validation: Confirming that recombinant PAR1 retains functional activity is critical before use in binding or signaling studies

To address these challenges, researchers should:

  • Follow manufacturer storage and reconstitution guidelines precisely

  • Validate each batch of recombinant protein using functional assays

  • Include appropriate positive and negative controls in all experiments

  • Consider using tagged versions of PAR1 (e.g., His-tagged) for easier detection and purification

How can researchers address data inconsistencies in PAR1 knockout studies?

When inconsistencies arise in PAR1 knockout studies, consider the following approaches:

  • Genetic background effects: Ensure PAR1 KO mice are properly backcrossed to the desired background strain, as the C57BL/6 background used in published studies may influence results

  • Age and sex considerations: Control for age and sex of experimental animals, as these factors can affect bone phenotypes

  • Housing conditions: Standardize housing conditions to minimize environmental variables

  • Cell isolation protocols: Use consistent protocols for isolating bone marrow cells and differentiating osteoclasts

  • Cytokine concentrations: Standardize concentrations of M-CSF, RANKL, and TNF used in experiments

  • Quantification methods: Employ consistent methods for quantifying osteoclast formation and bone parameters

  • Alternative models: Consider using conditional knockout models or inducible systems to overcome developmental compensations

Systematic troubleshooting of these variables can help resolve data inconsistencies and improve experimental reproducibility.

What quality control measures should be implemented when using recombinant rat PAR1 in research?

To ensure reliable and reproducible results with recombinant rat PAR1, implement the following quality control measures:

  • Purity assessment: Verify protein purity (>95%) using SDS-PAGE

  • Endotoxin testing: Confirm endotoxin levels are below acceptable thresholds (<1.0 EU per 1μg) using the LAL method

  • Stability testing: Monitor protein stability through accelerated thermal degradation tests (e.g., incubation at 37°C for 48h)

  • Functional validation: Confirm biological activity using appropriate functional assays

  • Batch consistency: Test multiple batches to ensure consistent performance

  • Storage verification: Periodically verify protein integrity after storage

  • Positive controls: Include well-characterized positive controls in experiments

These quality control measures will help ensure that experimental outcomes reflect true biological effects rather than artifacts of protein quality or handling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.