Recombinant Rat Proteinase-activated receptor 2 (F2rl1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure

  • Gene and Protein: The F2rl1 gene spans two exons and encodes a 397-amino acid protein with 83% sequence identity to mouse PAR2 .

  • Receptor Architecture: PAR2 is a 7-transmembrane domain receptor with an N-terminal domain that serves as a proteolytic cleavage site .

  • Activation Mechanism: Proteases (e.g., trypsin, tryptase) cleave the extracellular N-terminus, exposing a tethered ligand (e.g., SLIGRL-NH₂ in rodents) that binds to extracellular loop 2 (ECL2) to activate signaling .

Key Agonists and Antagonists

CompoundRoleSource
SLIGRL-NH₂ (2-at-LIGRL)Synthetic peptide agonist (rodent)
2f-LIGRLO-NH₂PAR2-specific agonist (human)
LSIGRL-NH₂Scrambled control peptide (inactive)
Tryptase, Neutrophil ElastaseEndogenous proteases activating PAR2

In Vitro Signaling Studies

  • Calcium Signaling: Recombinant PAR2 activation in dorsal root ganglion (DRG) neurons induces intracellular calcium influx .

  • ERK Phosphorylation: Agonist-induced ERK1/2 activation is observed in PAR2-expressing neurons, linked to chronic pain mechanisms .

  • Fibrotic Pathways: PAR2 transactivates epidermal growth factor receptor (EGFR) and TGFβ receptors, promoting Smad2 phosphorylation and connective tissue growth factor (CTGF) expression in renal fibrosis models .

In Vivo Disease Models

ModelKey FindingsSource
TNBS-induced colitisPAR2 activation (SLIGRL-NH₂) reduces inflammation and IFN-γ secretion
Radiation-induced fibrosisPAR2 upregulation in intestinal myofibroblasts; mast cell-derived proteases drive fibrosis
Chronic kidney diseasePAR2 knockout attenuates renal fibrosis via reduced TGFβ/EGFR signaling

Inflammatory and Pain Pathways

  • Anti-inflammatory Role: PAR2 activation suppresses T helper cell type 1 (Th1) cytokines and promotes healing in colitis .

  • Pain Mechanisms:

    • Mechanical Hyperalgesia: PAR2 agonists (e.g., 2-at-LIGRL) induce mechanical allodynia via sensory neuron activation .

    • Thermal Hyperalgesia: Mediated by non-neuronal PAR2 (e.g., in mast cells) and neutrophil elastase .

Fibrotic and Metabolic Disorders

  • Renal Fibrosis: PAR2 transactivation of EGFR and TGFβ pathways drives Smad2-dependent CTGF expression .

  • Radiation Injury: PAR2 overexpression in intestinal tissue correlates with collagen accumulation and delayed fibrosis .

Expression Patterns

  • Tissue Distribution: Expressed in epithelial cells (colon, skin), immune cells (mast cells, macrophages), and sensory neurons .

  • Neuronal Subpopulations:

    • DRG Neurons: ~3–4% of neurons coexpress F2rl1 with P2rx3 (P2X3 receptor), Il31ra (itch receptor), and Nppb (natriuretic peptide) .

    • Itch vs. Pain Signaling: PAR2-expressing neurons primarily drive pain (mechanical allodynia) rather than itch .

Transactivation and Cross-Talk

  • TLR4 and EGFR: PAR2 transactivates TLR4 in inflammation and EGFR in fibrosis, amplifying downstream signaling .

  • CGRP Dependency: Anti-inflammatory effects in colitis require neuropeptide CGRP and sensory neuron signaling .

Challenges and Future Directions

  • Specificity Issues: Many PAR2 agonists (e.g., compound 48/80) activate Mas-related GPCRs, complicating interpretation .

  • Therapeutic Targets: PAR2 antagonists may mitigate fibrosis (e.g., in kidney disease), while agonists could treat inflammatory bowel disease .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, please specify any format preferences in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its incorporation.
Synonyms
F2rl1; Par2; Proteinase-activated receptor 2; PAR-2; Coagulation factor II receptor-like 1; Thrombin receptor-like 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
37-397
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
SLIGRLDTPPPITGKGAPVEPGFSVDEFSASVLTGKLTTVFLPVIYIIVFVIGLPSNGMA LWVFFFRTKKKHPAVIYMANLALADLLSVIWFPLKISYHLHGNDWTYGDALCKVLIGFFY GNMYCSILFMTCLSVQRYWVIVNPMGHSRKRANIAVGVSLAIWLLIFLVTIPLYVMRQTI YIPALNITTCHDVLPEEVLVGDMFSYFLSLAIGVFLFPALLTASAYVLMIKTLRSSAMDE HSEKKRRRAIRLIITVLSMYFICFAPSNVLLVVHYFLIKSQRQSHVYALYLVALCLSTLN SCIDPFVYYFVSKDFRDQARNALLCRSVRTVKRMQISLTSNKFSRKSSSYSSSSTSVKTS Y
Uniprot No.

Target Background

Function

Proteinase-activated receptor 2 (PAR2) is a G protein-coupled receptor for trypsin and trypsin-like enzymes. Its activation triggers various signaling pathways, including phospholipase C (PLC), intracellular calcium mobilization, mitogen-activated protein kinase (MAPK), I-kappaB kinase/NF-kappaB, and Rho signaling. Cleaved F2R/PAR1 can also transactivate PAR2. PAR2 plays a crucial role in modulating inflammatory responses and regulating both innate and adaptive immunity, acting as a sensor for proteolytic enzymes released during infection. Generally, it promotes inflammation, signaling synergistically with TLR4 and possibly TLR2 in inflammatory responses, and modulating TLR3 signaling. PAR2 exhibits a protective effect on endothelial barrier integrity, involving coagulation factor X, and regulates endothelial cell barrier function during neutrophil extravasation, potentially through proteolytic cleavage by PRTN3. While proposed to have a bronchoprotective role in airway epithelium, PAR2 has also been shown to compromise the airway epithelial barrier by disrupting E-cadherin adhesion. It regulates vascular tone; activation leads to hypotension, likely through vasodilation. PAR2 interacts with various G protein alpha subunits (GNAQ, GNA11, GNA14, GNA12, and GNA13), but not with G(o) alpha, G(i) subunit alpha-1, and G(i) subunit alpha-2. Considered a class B receptor, PAR2 internalizes as a complex with arrestin, trafficking to endosomal vesicles for extended periods, likely representing a desensitized state. PAR2 mediates the inhibition of TNF-alpha-stimulated JNK phosphorylation via coupling to GNAQ and GNA11, involving the dissociation of RIPK1 and TRADD from TNFR1. It mediates phosphorylation of the nuclear factor NF-kappa-B RELA subunit at Ser-536, primarily independent of G proteins, involving IκB kinase β (IKBKβ). PAR2 is involved in cellular migration, cytoskeletal rearrangement, and chemotaxis through β-arrestin-promoted scaffolds, independent of GNAQ and GNA11, and promotes cofilin dephosphorylation and actin filament severing. It induces COPS5 redistribution and JNK cascade activation mediated by COPS5. PAR2 participates in leukocyte recruitment to inflammation sites and is a major PAR capable of modulating eosinophil functions such as proinflammatory cytokine secretion, superoxide production, and degranulation. During inflammation, it promotes dendritic cell maturation, lymph node trafficking, and subsequent T-cell activation. It contributes to the antimicrobial response of innate immune cells; activation enhances phagocytosis of Gram-positive bacteria and killing of Gram-negative bacteria. It acts synergistically with interferon-gamma to enhance antiviral responses.

Gene References Into Functions
  1. Impaired PAR2-induced aortic relaxation in aged spontaneously hypertensive rats suggests decreased NO bioavailability as a potential therapeutic target for hypertension-associated vasculopathies. PMID: 29709920
  2. PAR2 signaling in muscle sensory nerves contributes to amplified exercise pressor reflex via TRPA1 in rats with femoral artery ligation. PMID: 29131007
  3. PAR2 plays a significant role in mediating renal injury induced by glomerulosclerosis. PMID: 28245472
  4. PAR2 stimulation of NO production through Ser1177-eNOS phosphorylation suggests a regulatory mechanism for sustaining agonist-mediated vasodilation in metabolic syndrome. PMID: 26760532
  5. XZP alleviates breast cancer-induced bone pain by inhibiting the PAR2 signaling pathway. PMID: 26133236
  6. The PAR-2 carboxyl tail regulates receptor localization, internalization, intracellular Ca(2+) responses, and signaling to ERK and AKT. PMID: 25519044
  7. PAR-2 activation directly affects peripheral sympathetic activity via N-type Ca2+ channels. PMID: 25410909
  8. PAR2-mediated relaxation is preserved in small mesenteric arteries of rats with metabolic syndrome. PMID: 25109437
  9. Trypsin generated during acute pancreatitis may contribute to lung injury progression via PAR-2 activation in alveolar macrophages. PMID: 24897276
  10. Increased PAR2 expression in dorsal root ganglia contributes to mechanical allodynia and thermal hyperalgesia in bone cancer rats. PMID: 24057889
  11. PAR2 plays a key role in calcium-related cell homeostasis in conditions such as tissue injury or inflammation. PMID: 23463389
  12. PAR2 activation triggers NF-kappaB signaling and upregulates BDNF function. PMID: 24886294
  13. PAR2 activation blockade decreases endothelin-1 levels in the kidney during endotoxemia. PMID: 24641950
  14. Chronic in-vivo PAR2 activation lowers systolic blood pressure in mice. PMID: 23627841
  15. Cromolyn sodium may reduce intestinal ischemia-reperfusion injury by stabilizing mast cell membranes and inhibiting tryptase and PAR-2 expression. PMID: 23290058
  16. Cross-talk between PAR2 and TLR4 contributes to vascular homeostasis. PMID: 22957757
  17. Renal PAR2 controls blood pressure and plasma potassium levels. PMID: 23430254
  18. In Trichinella spiralis infection, intestinal PAR-2 function and expression vary depending on the inflammatory phase. PMID: 23238933
  19. PAR2 activation is critical for nerve injury-induced neuronal hyperexcitability and cAMP-PKA activation. PMID: 22541444
  20. Mast cell-released tryptase mediates acute lung injury induced by intestinal ischemia-reperfusion by activating PAR-2 to produce IL-8. PMID: 22200983
  21. KLK8 and KLK14 signal differentially via PARs to affect tissue function. PMID: 22505524
  22. PAR2 receptor activation enhances pain response, possibly via inhibiting dorsal horn GABAergic neurotransmission. PMID: 22018669
  23. PAR-2 upregulation depends on PKC activity, primarily via Ca(2+)-sensitive isoforms. PMID: 22227167
  24. PAR-2 inhibition reverses experimental pulmonary hypertension, suggesting a novel role in lung vascular remodeling. PMID: 22461388
  25. Both PAR-2 and mast cells are involved in diclofenac-induced small intestinal mucosa injury. PMID: 21914290
  26. PAR-2 activation affects myometrial contractility during pregnancy. PMID: 22244874
  27. A PAR2 antagonist shows disease-modifying effects in experimental colitis, supporting a pathogenic role for PAR2 and PAR2-activating proteases. PMID: 22028393
  28. ISP1 may signal by cleaving and activating PARs 1, 2, and 4. PMID: 22132161
  29. Neutrophil elastase induces biased PAR(2) signaling, while cathepsin-G and proteinase-3 have a silencing effect. PMID: 21576245
  30. Thermal hyperalgesia in chronic pancreatitis is associated with PAR-2 upregulation in dorsal root ganglia. PMID: 21311307
  31. PAR-2 mRNA and protein expression increase in the intestinal mucosa after ischemia-reperfusion. PMID: 21461568
  32. Bacillary dysentery causes long-term PAR-2 downregulation in the distal colon. PMID: 20347884
  33. Oxidative stress upregulates PAR-2 in endothelial cells, enhancing endothelium-dependent relaxation. PMID: 20431298
  34. PAR-2 activation causes dural artery vasodilation, partially mediated by nitric oxide. PMID: 20487037
  35. PAR-2 mRNA and protein expression correlates with mast cell increase in experimental rat liver fibrosis. PMID: 17064469
  36. PAR-2 agonist SLIGRL-NH2 reduces myocardial apoptosis by upregulating Bcl-2 and PAR-2 mRNA and downregulating Bax expression. PMID: 20128384
  37. PAR-2 expression and vasodilator function are unchanged in middle cerebral arteries of spontaneously hypertensive rats after hypertensive encephalopathy or cerebral hemorrhage. PMID: 19954757
  38. PAR(2) activation modulates acid signaling in pulmonary sensory neurons. PMID: 20044436
  39. PAR-2 plays a key role in the inflammatory and coagulation processes of LPS-induced renal failure. PMID: 19333145
  40. PAR-2 expression suppression under inflammatory conditions is partially induced by nitric oxide produced in the colonic muscularis externa by proinflammatory cytokines. PMID: 20046028
  41. Inflammation upregulates the NMDA receptor and activates the PAR2 receptor on colospinal afferent neurons. PMID: 19772634
  42. Activated rat stellate cells show increased PAR-1 and -2 mRNA and PAR-2 protein expression as they transform to a myofibroblastic phenotype. PMID: 11867180
  43. PAR-2 may promote visceral hyperalgesia in rats. PMID: 11910355
  44. PAR-2 is expressed in the afferent arteriole, and its activation causes afferent arteriolar vasodilation. PMID: 11934700
  45. Enhanced PAR-2 activation improves ischemic preconditioning efficiency and reduces cardiac inflammation. PMID: 12003804
  46. PAR-2 expression does not significantly change in the hippocampus after severe ischemic insult. PMID: 12165407
  47. NMDA receptors and the nitric oxide pathway are involved in nociception/hyperalgesia elicited by PAR-2 activation. PMID: 12183046
  48. PAR-2 is expressed in the pancreas and parotid gland, mediating amylase secretion. PMID: 12231404
  49. Par-2 mRNA is upregulated in the developing rat eye and adult retina after optic nerve crush. PMID: 12836167
  50. PAR-2 may have a dual role in acute pancreatitis: protecting cells while mediating systemic complications. PMID: 15188179
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Proteinase-activated receptor 2 (F2rl1) and what are its key characteristics?

Proteinase-activated receptor 2 (F2rl1), commonly known as PAR2, is a member of the G-protein coupled receptor 1 protein family that functions as a receptor for trypsin and trypsin-like enzymes coupled to G proteins. In rats, as in humans, PAR2 is widely expressed in various tissues with particularly high levels in the pancreas, liver, kidney, small intestine, and colon . The protein is localized in the cell membrane and plays significant roles in multiple physiological and pathological processes including inflammation, fibrosis, and hypertrophy . PAR2 has several synonyms including CFIIRL1, F2RL1, GPCR11, coagulation factor II receptor-like 1, G-protein coupled receptor 11, and proteinase-activated receptor 2 .

How does rat PAR2 compare structurally and functionally to human PAR2?

While the search results don't provide specific comparative data between rat and human PAR2, research has identified that the rat PAR2 gene has orthologs in multiple species including mouse, human, bovine, frog, chimpanzee, and chicken . The functional conservation across species makes rat PAR2 a valuable model for studying mechanisms potentially applicable to human physiology and pathology. In experimental settings, rat PAR2 (UniProt: Q63645) serves as an important research target for understanding receptor activation, signaling pathways, and downstream effects that may have translational relevance to human health and disease .

What are the most reliable methods for detecting PAR2 expression in rat tissue samples?

Several methodologies can be employed for detecting PAR2 expression in rat tissue samples:

  • mRNA detection: Real-time PCR is an effective method for quantifying PAR2 mRNA expression in cardiac and other tissues. As demonstrated in research with PAR2-deficient mice, this approach can confirm the absence of PAR2 expression or quantify expression levels (e.g., 40% reduction after angiotensin II treatment) .

  • In situ hybridization: This technique allows visualization of PAR2 expression at the cellular level within tissue sections. It has been successfully used to localize PAR2 expression in vascular smooth muscle cells, interstitial cells, and cardiomyocytes, revealing differential expression patterns across cell types .

  • ELISA: Sandwich ELISA kits specific for rat PAR2 provide a sensitive method for quantifying PAR2 levels in serum, plasma, and cell culture supernatants with high specificity. These assays typically offer sensitivity around 4.688 nIU/ml with detection ranges of approximately 7.813-500 nIU/ml .

  • Immunohistochemistry: Though challenging due to antibody specificity issues (some researchers report difficulty finding suitable antibodies for mouse PAR2), this method can be valuable when optimized properly .

What are the common challenges in detecting recombinant rat PAR2 and how can they be addressed?

Detecting recombinant rat PAR2 presents several challenges that researchers should anticipate:

  • Antibody specificity issues: Finding suitable antibodies for rat PAR2 can be difficult, as noted in studies where researchers failed to locate appropriate antibodies for immunohistochemical detection and had to resort to alternative methods like in situ hybridization . To address this challenge, thorough validation of antibodies with positive and negative controls (e.g., PAR2-deficient tissues) is essential.

  • Expression level variations: PAR2 expression can fluctuate in response to stimuli. For instance, angiotensin II treatment has been shown to reduce cardiac PAR2 expression by approximately 40% . This necessitates careful experimental design with appropriate timing for sample collection.

  • Cell-type specific expression: PAR2 shows differential expression across cell types, with higher levels in vascular smooth muscle cells and interstitial cells compared to cardiomyocytes . Single-cell resolution techniques or careful microdissection may be required for accurate cell-type specific analysis.

  • Protein localization: As a membrane protein, PAR2 extraction and solubilization require specialized protocols to maintain protein integrity and conformation.

How can recombinant rat PAR2 be effectively used in signal transduction studies?

Recombinant rat PAR2 can be utilized in signal transduction studies through several approaches:

  • ERK1/2 phosphorylation assays: PAR2 activation influences ERK1/2 phosphorylation, a key signaling pathway in various cellular processes. Immunofluorescence staining for phosphorylated ERK1/2 can quantify this activation in response to PAR2 stimulation or inhibition, as demonstrated in experiments with isolated rat cardiac fibroblasts .

  • Pathway inhibitor studies: Using specific PAR2 inhibitors such as AZ3451 (at concentrations of approximately 2 μM) in combination with stimulatory agents like angiotensin II helps elucidate the specific contribution of PAR2 to observed signaling responses .

  • TGF-β signaling analysis: PAR2 interactions with TGF-β receptor 1 affect downstream signaling. Measuring Smad2/3 phosphorylation and TGF-β-related gene expression provides insights into this crosstalk. In primary cardiac fibroblasts, PAR2 inhibition has been shown to significantly increase Tgfb2 mRNA expression in unstimulated cells .

  • Receptor internalization studies: PAR2 affects the internalization of other receptors, including TGF-β receptor and PAR1, through interactions with caveolin-1. Tracking receptor trafficking can illuminate these regulatory mechanisms .

What are the best experimental models for studying rat PAR2 function in cardiovascular research?

Several experimental models have proven valuable for studying rat PAR2 function in cardiovascular research:

  • Angiotensin II-induced hypertension model: Continuous infusion of angiotensin II via osmotic minipumps for 4 weeks creates a reliable hypertension model that can be used to study PAR2's role in cardiac injury, hypertrophy, and fibrosis .

  • Primary cardiac fibroblast cultures: Isolated rat cardiac fibroblasts provide an in vitro system for investigating PAR2's role in fibrotic responses and signaling pathways. These cells can be treated with angiotensin II (to mimic hypertensive conditions) and PAR2 inhibitors to assess specific pathway involvement .

  • Genetic models: Comparison between wildtype and PAR2-deficient animals enables assessment of PAR2's role in cardiac pathophysiology. These models have revealed distinct phenotypes, with PAR2-deficient mice showing reduced left ventricular hypertrophy but increased cardiac fibrosis in response to angiotensin II .

  • Spontaneously hypertensive rats: This model has been used to study PAR2's pro-fibrotic effects in hypertensive heart injury, with interventions such as rivaroxaban (which inhibits activated factor X and may reduce PAR2 activation) reducing cardiac fibrosis .

Experimental ModelKey ApplicationsNotable Findings
Angiotensin II infusionHypertension, cardiac injuryPAR2-deficient mice develop less LVH but more fibrosis
Primary cardiac fibroblastsCellular signaling, fibrosisPAR2 inhibition affects ERK1/2 phosphorylation and TGF-β pathway
PAR2-deficient miceMechanism studiesCardiac PAR2 expression decreases by ~40% after AngII treatment
Spontaneously hypertensive ratsChronic hypertensive injuryPAR2 inhibition reduces cardiac fibrosis

How does PAR2 interact with other signaling pathways in cardiac hypertrophy and fibrosis?

PAR2 engages in complex interactions with multiple signaling pathways in cardiac pathophysiology:

How can contradictory findings regarding PAR2's role in cardiac fibrosis be reconciled?

The literature presents contradictory findings regarding PAR2's role in cardiac fibrosis, which require careful analysis:

  • Temporal considerations: Different experimental endpoints may capture distinct phases of the fibrotic response. For example, the study by Meyer zu Schwabedissen et al. found increased fibrosis in PAR2-deficient mice after 4 weeks of angiotensin II treatment, while Matsuura et al. observed reduced fibrosis in PAR2-deficient mice at just 2 weeks .

  • Regional differences: The contradictory findings might be attributed to regional cardiac differences. Meyer zu Schwabedissen et al. examined fibrosis in the left ventricle, while Matsuura et al. focused on the left atrium . These cardiac chambers may exhibit distinct regulatory mechanisms and responses to PAR2 manipulation.

  • Compensatory mechanisms: Complete genetic deletion of PAR2 may trigger compensatory adaptations in related pathways that acute pharmacological inhibition does not induce. This could explain why PAR2 antagonist FSLLRY reduced collagen-3 expression in hypertensive models, contrasting with increased fibrosis in PAR2-deficient mice .

  • Background strain and model differences: Variations in mouse strains or specific details of model implementation (dose of angiotensin II, duration of treatment) might contribute to discrepant findings, emphasizing the importance of standardized experimental approaches.

To reconcile these contradictions, researchers should consider implementing time-course studies, multiregional cardiac analysis, and comparison of genetic versus pharmacological PAR2 inhibition within the same experimental paradigm.

What are the optimal conditions for expressing and purifying recombinant rat PAR2?

While the search results don't provide specific protocols for expressing and purifying recombinant rat PAR2, general principles for G-protein coupled receptors can be applied with the following considerations:

  • Expression systems: Mammalian cell expression systems (e.g., HEK293, CHO cells) typically provide better folding and post-translational modifications for membrane proteins like PAR2 compared to bacterial systems. For functional studies, cells that don't endogenously express PAR2 should be selected to avoid background effects.

  • Fusion tags: Addition of affinity tags (His-tag, FLAG-tag) facilitates purification while fluorescent protein fusions (GFP, mCherry) enable tracking of expression and localization. The placement of tags (N-terminal vs. C-terminal) should be carefully considered to avoid interfering with receptor function.

  • Solubilization: As a membrane protein, PAR2 requires appropriate detergents for solubilization. Mild detergents (DDM, LMNG) at concentrations above their critical micelle concentration help maintain protein structure and function during extraction.

  • Quality control: Multiple methods should be employed to assess the quality of purified recombinant PAR2, including SDS-PAGE, Western blotting with specific antibodies, and functional assays to confirm retained activity.

What considerations are important when designing loss-of-function studies for rat PAR2?

Designing effective loss-of-function studies for rat PAR2 requires careful consideration of several factors:

  • Model selection: Both genetic and pharmacological approaches have value. Genetic models (PAR2-deficient rats or mice) provide complete and constitutive receptor elimination, while pharmacological inhibition with agents like AZ3451 (typically used at ~2 μM) or the peptide antagonist FSLLRY offers temporal control over PAR2 inhibition .

  • Validation of PAR2 elimination: Thorough validation is essential, typically through real-time PCR to confirm absence of PAR2 mRNA expression in genetic models or functional assays to verify receptor inhibition in pharmacological approaches .

  • Control for compensatory mechanisms: Chronic absence of PAR2 in genetic models may trigger compensatory upregulation of related pathways that confound interpretation. Inducible knockout systems or comparison with acute pharmacological inhibition can help address this issue.

  • Cell-type specific considerations: Given PAR2's differential expression across cardiac cell types (higher in vascular smooth muscle cells and interstitial cells than in cardiomyocytes), cell-type specific knockout approaches may provide more nuanced insights than global deletion .

  • Endpoint selection: The choice of experimental endpoints should reflect PAR2's diverse functions. For cardiac studies, measurements of hypertrophy (heart weight, left ventricular cross-sectional area), fibrosis (Sirius Red staining, collagen IV staining), and molecular signaling (ERK1/2 phosphorylation, TGF-β pathway activation) provide complementary insights .

How do findings from rat PAR2 studies translate to human cardiovascular pathophysiology?

Findings from rat PAR2 studies have several translational implications for human cardiovascular pathophysiology:

  • Conserved molecular mechanisms: The PAR2 receptor shows structural and functional conservation across species, suggesting that fundamental mechanistic insights from rat models may apply to human cardiovascular pathophysiology . This conservation supports the translational relevance of findings regarding PAR2's role in inflammation, fibrosis, and hypertrophy.

  • Therapeutic targeting: Experimental approaches demonstrating beneficial effects of PAR2 inhibition in rat models inform potential therapeutic strategies for human cardiovascular diseases. For example, findings that PAR2 deficiency reduces left ventricular hypertrophy in response to angiotensin II suggest that PAR2 antagonists might have therapeutic value in hypertensive heart disease .

  • Biomarker potential: Understanding PAR2's regulation in response to cardiovascular stress (e.g., 40% reduction in cardiac PAR2 expression after angiotensin II treatment) highlights its potential as a biomarker of cardiovascular pathophysiology . Similar expression patterns in human tissues would support its clinical utility.

  • Pathway conservation: The interaction between PAR2 and established pathways in cardiovascular disease (ERK1/2, TGF-β) suggests conserved signaling networks that can guide targeted therapeutic approaches in humans. Particularly, PAR2's modulation of FGF23 expression may have implications for cardiac hypertrophy in human disease .

What are the potential therapeutic applications of targeting PAR2 in cardiovascular diseases?

Based on experimental findings, several potential therapeutic applications for PAR2 targeting in cardiovascular diseases can be identified:

  • Anti-hypertrophic strategies: PAR2 deficiency reduces left ventricular hypertrophy in angiotensin II-treated mice, suggesting PAR2 antagonists might limit pathological cardiac hypertrophy in hypertensive heart disease . This approach would be particularly relevant for conditions where inappropriate hypertrophy contributes to heart failure progression.

  • Balanced fibrosis modulation: The complex role of PAR2 in cardiac fibrosis requires careful consideration. While some studies show increased fibrosis in PAR2-deficient mice, others demonstrate reduced fibrosis with PAR2 inhibition . Stage-specific or region-specific PAR2 modulation might be necessary to achieve optimal therapeutic outcomes.

  • Vascular protection: PAR2's expression in vascular smooth muscle cells and endothelial cells suggests potential applications in vascular protection. Targeted delivery of PAR2 modulators to the vasculature might address vascular remodeling in hypertension and other cardiovascular diseases .

  • Combination with existing therapies: PAR2 antagonists might complement established cardiovascular therapies. For example, combining PAR2 inhibition with angiotensin II receptor blockers could potentially provide synergistic benefits by targeting multiple aspects of cardiovascular pathophysiology .

The clinical development of PAR2-targeted therapies will require careful optimization of compound specificity, delivery strategies, and treatment timing to maximize beneficial effects while minimizing potential adverse consequences.

What are the most promising areas for future research using recombinant rat PAR2?

Several promising areas for future research using recombinant rat PAR2 include:

  • Temporal dynamics of PAR2 signaling: Investigating the time-dependent effects of PAR2 activation on cardiac hypertrophy and fibrosis would help reconcile conflicting findings in the literature. Sequential analysis at multiple timepoints following angiotensin II treatment could reveal phase-specific PAR2 functions .

  • Regional cardiac differences: Comparative studies of PAR2's role in different cardiac chambers (atria vs. ventricles) and regions (epicardium vs. endocardium) would provide more nuanced understanding of its function. This approach could explain why studies examining different cardiac regions have yielded contradictory results regarding PAR2's fibrotic effects .

  • Cell-type specific functions: Developing cell-type specific PAR2 knockout or overexpression models would illuminate its differential roles in cardiomyocytes, fibroblasts, vascular smooth muscle cells, and endothelial cells. The observed expression differences across these cell types suggest potentially distinct functions .

  • Interaction with non-canonical pathways: Beyond established ERK1/2 and TGF-β pathways, exploration of PAR2's interaction with other signaling networks, particularly those involving FGF23, could reveal novel therapeutic targets. The significant differential regulation of FGF23 between wildtype and PAR2-deficient mice warrants further investigation .

  • Receptor crosstalk: Investigating PAR2's interaction with other receptors beyond TGF-β receptor 1, particularly those involved in hypertensive signaling, would provide a more comprehensive understanding of its regulatory role in cardiovascular pathophysiology .

What methodological innovations could advance the study of rat PAR2 function and signaling?

Several methodological innovations could significantly advance the study of rat PAR2 function and signaling:

  • CRISPR-based approaches: Development of CRISPR/Cas9 techniques for precise genetic manipulation of PAR2 in rat models, including conditional and inducible knockout systems, would enable more sophisticated functional studies while minimizing compensatory adaptations.

  • Single-cell analysis: Application of single-cell transcriptomics and proteomics to PAR2-expressing tissues would provide unprecedented resolution of cell-type specific expression patterns and responses to PAR2 manipulation, building upon the cellular heterogeneity observed with in situ hybridization .

  • Advanced imaging techniques: Implementation of super-resolution microscopy and live-cell imaging with fluorescently tagged PAR2 would enable real-time visualization of receptor trafficking, activation, and interaction with other signaling molecules in response to stimuli.

  • Phosphoproteomics: Comprehensive phosphoproteomic analysis following PAR2 activation or inhibition would map the full spectrum of downstream signaling events beyond currently studied pathways, potentially identifying novel therapeutic targets.

  • Tissue-specific drug delivery: Development of targeted delivery systems for PAR2 modulators to specific cardiac regions or cell types would enable more precise manipulation of PAR2 function in vivo, potentially resolving the apparently contradictory effects observed in different experimental paradigms .

These methodological innovations would collectively advance our understanding of PAR2 biology and accelerate the development of PAR2-targeted therapeutic strategies for cardiovascular diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.